Conserved Protein Domain Family
Pneumo_att_G

?
pfam05539: Pneumo_att_G 
Pneumovirinae attachment membrane glycoprotein G
Statistics
?
PSSM-Id: 114270
View PSSM: pfam05539
Aligned: 3 rows
Threshold Bit Score: 508.049
Threshold Setting Gi: 81969063
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q65305     1 MGSELYIIEGVSSSEIVLKQVLRRSQKILLGLVLSALGLTLTSTIVISICISVEQVKLRQCvDTYWAENGSLHPGQSTEN 80  Turkey rhinotrachei...
AEI52899   1 MGSKLYMVQGTSAYQTAVGFWLDIGRRYILAIVLSAFGLTCTVTIALTVSVIVEQSVLEEC-RNYNGGDRDWWSTTQEQP 79  Avian metapneumovirus
Q9DXA1     1 MGAKLYAISGASDAQLMKKTCAKLLEKVVPIIILAVLGITGTTTIALSISISIERAVLSDC-TTQLRNGTTSGSLSNPTR 79  Avian metapneumovirus
Q65305    81 TSTRGKTTTKDPRRLQATGAGKFESCGYVQVVDGDMHDRSYAVLGGVDCLGLLALCESGPICQGDTWSEDGNFCRCTFSS 160 Turkey rhinotrachei...
AEI52899  80 TTAPSATPAGNYGGLQTARTRKSESCLHVQISYGDMYSRSDTVLGGFDCMGLLVLCKSGPICQRDNQVDPTALCHCRVDL 159 Avian metapneumovirus
Q9DXA1    80 STTSTAVTTRDIRGLQTTRTRELKSCSNVQIAYGYLHDSSNPVLDSIGCLGLLALCESGPFCQRNYNPRDRPKCRCTLRG 159 Avian metapneumovirus
Q65305   161 HGVSCCKKPKSKaTTAQRNSKPANskSTPPVHSDRASKEHNPSQGEQPrrgpTSSKTTIASTPS--TEDTAKPTISKPKL 238 Turkey rhinotrachei...
AEI52899 160 SSVDCCKVNKIS-TNSSTTSEPQK--TNPAWPSQDNTDSDPNPQGITT----STATLLSTSLGLmlTSKTGTHKSGPPQA 232 Avian metapneumovirus
Q9DXA1   160 KDISCCKEPPTAvTTSKTTPWGTEv--HPTYPTQVTPQSQPATMAHQT----ATANQRLSTTEPvgSQGNTTSSNPEQQT 233 Avian metapneumovirus
Q65305   239 TIRPSQRGPSGSTKAASSTPSHKTNT-RGTSKTTDQRPRTGPTPERPRQTHSTATPPPTTpiHKGRAPTPKPTTDlkvnp 317 Turkey rhinotrachei...
AEI52899 233 LPGSNTNGKTTTDRELGSTNQPNSTT-NGQHNKHTQRMTLPPSYDNTRTILQHTTPWEKT--FSTYKPTHSPTNE----- 304 Avian metapneumovirus
Q9DXA1   234 EPPPS-------PQHPPTTTSQDQSTeTADGQEHTPTRKTPTATSNRRSP--------TPkrQETGRATPRNTATtqsgs 298 Avian metapneumovirus
Q65305   318 regstsptAIQKNPTTQsNLVDCTLSDPDEPQRICYQVGTYNPSQSGTCNIEVPKCSTYGHACMATLYDTPFNCWRRTRR 397 Turkey rhinotrachei...
AEI52899 305 --------SDQSLPTTQ-NSINCEHFDPQGKEKICYRVGSYNSNITKQCRIDVPLCSTYNTVCMKTYYTEPFNCWRRIWR 375 Avian metapneumovirus
Q9DXA1   299 spphssppGVDANMEGQ-----CKELQAPKPNSVCKGLDIYREALPRGCDKVLPLCKTSTIMCVDAYYSKPPICFGYNQR 373 Avian metapneumovirus
Q65305   398 CICDSGGELIEWCCTS 413 Turkey rhinotracheitis virus
AEI52899 376 CLCDDGVGLVEWCCTS 391 Avian metapneumovirus
Q9DXA1   374 CFCMETFGPIEFCCKS 389 Avian metapneumovirus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap