Conserved Protein Domain Family
Peptidase_C42

?
pfam05533: Peptidase_C42 
Beet yellows virus-type papain-like endopeptidase C42
Members of the Closteroviridae and Potyviridae families of plant positive-strand RNA viruses encode one or two papain-like leader proteinases, belonging to Merops peptidase family C42.
Statistics
?
PSSM-Id: 114264
View PSSM: pfam05533
Aligned: 8 rows
Threshold Bit Score: 111.331
Threshold Setting Gi: 81993673
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O10467  882 EDLKDGYCYIRHIAEVCLSMGKVFFRRDV----NLGAFPYVFEVQHRLERLYGKRAVEYGVRGYFSATRLYHCCFTDSPR 957  Citrus tristeza virus
O71209  297 IRYPNGFCYLAHCRYACAFLLRGFDPKRF----DIGAFPTAAKLRNRMVSELGERSLGLNLYGAYTSRGVFHCDYDAKFI 372  Grapevine leafroll-...
Q8BEP9  754 DKYKNGYCYLAHCRYASAFLLKGFHPAVF----DIGANPTAAKLRSRMVSVLGDRSLSLNLYGSFTSRGIFHCDYDAAYV 829  Grapevine rootstock...
Q8BEP9  485 ECYPDGLCYMAHMRYLCAFFCQPFRESDY----PLGSWPSVARLKALVLKRFGDEALNIGVRGYYVSRRAFHCDYDSKYA 560  Grapevine rootstock...
O71209   23 VIYPDGRCYLAHMRYLCAFYCRPFRESDY----ALGMWPTVARLRACVEKNFGVEACGIALRGYYTSRNVYHCDYDSAYV 98   Grapevine leafroll-...
O89906  502 YRPGEGLCYLAHAALCCALQKRTFREEDF----FVGMYPTKFVFAKRLTEKLGPSALKHPVRGRQVSRSLFHCDVASAFS 577  Beet yellows virus
Q8B3T9  397 AKVRDGQCYVRHVFDVALYFGR---RADLsvrrALGMYPTVGALKAYLVREYGRDSLKVPMRGTYTFGSVFHCLSTKSSV 473  Citrus tristeza virus
Q8B3T9  888 ESLKDGYCYIRHFAEVSLSMGRIFFRRDV----DLGPFPYVFEVQHRLERLYGKAALRYGVRGQYSAPRCFHCCYNDSPR 963  Citrus tristeza virus
O10467  958 -PFKSLNMYhkMGG 970  Citrus tristeza virus
O71209  373 kDLRLMSAV--IAG 384  Grapevine leafroll-associated virus 2
Q8BEP9  830 kDLRFMSAI--VAG 841  Grapevine rootstock stem lesion associated virus
Q8BEP9  561 rSLMRLAGY--VGG 572  Grapevine rootstock stem lesion associated virus
O71209   99 kYFRNLSGR--IGG 110  Grapevine leafroll-associated virus 2
O89906  578 sPFYSLPRF--IGG 589  Beet yellows virus
Q8B3T9  474 -DLRSIPNHhlVGG 486  Citrus tristeza virus
Q8B3T9  964 -PMASFNGYhkMGG 976  Citrus tristeza virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap