1RYK


Conserved Protein Domain Family
CsbD

?
pfam05532: CsbD 
CsbD-like
CsbD is a bacterial general stress response protein. It's expression is mediated by sigma-B, an alternative sigma factor. The role of CsbD in stress response is unclear.
Statistics
?
PSSM-Id: 398918
Aligned: 89 rows
Threshold Bit Score: 32.1085
Threshold Setting Gi: 122266184
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1RYK_A        4 DEAGGNWKQFKGKVKEQWGKLTDDDMTIIEGKRDQLVGKIQERYGYQKDQAEK 56 
Q6A7T9        5 DKINSKSDEAVGAAKEKIGGLTDDSDLKSAGADQKASGKVAQKVEDVKDKAND 57  Cutibacterium acnes KPA171202
Q11J10       16 DELKGSAKKMRGTVKDEVGKATGDDKMRAEGKADKAEGSIQKGVGKAKDTVRD 68  Chelativorans sp. BNC1
ABV61191      9 DKAKGKTNQAKGQLKEKLGEATDHQKLKSEGKKDQAKGKLQDKKGDLKNHLNE 61  Bacillus pumilus SAFR-032
P70964        8 DKMKGGFNKAKGEVKDKVGDMADRTDMQAEGKKDKAKGEIQKDIGKAKDKFSD 60  Bacillus subtilis subsp. subtilis str. 168
Q8EN05        7 DKAKAIGKKIKGEAKDQWGSATDDPQRKAEGKRDKAKGEAQDTIADAKNN-NK 58  Oceanobacillus iheyensis HTE831
Q929L4        9 DKAKGLKDKVVGDAKDKFGKATDDKGKQVEGKAQKAKGEVEDKTGDAKKKLSe 61  Listeria monocytogenes EGD-e
WP_012175732  7 EKAEGKIHQVKGKFKEAAGIIAGNRDLEAVGKEEKKEGKIQEKLGQIKKLMDK 59  Desulfococcus oleovorans
WP_011939274  7 DKAEGTFHEAKGKVKEIAGKITDNPKLEAKGKGEKLVGKVQEKIGQVKKVLGK 59  Geobacter uraniireducens
Q5WD64        7 DKMKSAANKAKGATKEAAGKAADNKKMQADGKKDKLKGKAQEVEGDVKERMKE 59  Bacillus clausii KSM-K16
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap