4MZU


Conserved Protein Domain Family
FdtA

?
pfam05523: FdtA 
Click on image for an interactive view with Cn3D
WxcM-like, C-terminal
This family includes FdtA from Aneurinibacillus thermoaerophilus, which has been characterized as a dtdp-6-deoxy-3,4-keto-hexulose isomerase. It also includes WxcM from Xanthomonas campestris (pv. campestris).
Statistics
?
PSSM-Id: 398913
Aligned: 27 rows
Threshold Bit Score: 138.497
Threshold Setting Gi: 160338958
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4MZU_D        174 GVS--LHKFHLV----NDL-RGNLSVGEFE-KD--IPFTPKRYFTVFGVPNKEVRGEHAHKECKQFLICVSGNCSVLVDD 243 Shewanella den...
wustl:BD3538    2 DNKpvIIELPKF----LDK-RGNLSFVEEF-QH--VPFKIARSYWIYDVPGGEVRGGHAYKKNEEFIIALSGSFEVHIDD 73  Parabacteroide...
Q8F5R6          3 NTT--VSDLRKIkfwqHSK-NGVLSVFEGS-NEnsVPFSIARVFTISGVLIGGVRGNHAHRKCIQLVVCLIGSVTIEITD 78  Leptospira int...
Q11S51          4 KPH--WIHFTGI----GDEeVGYISVAQSN-RH--VPFEIKRVYWVYHTPEYIERGNHAHKACRQILIAAAGAVDVELEN 74  Cytophaga hutc...
Q2WBB6          2 TVA--DIQLQSIhs-vVDD-NGTLVVAEVG-RQ--VPFEIARIFSISGVGRGEDRGHHAHKKLSQMMICLSGAVEVTVDD 74  Magnetospirill...
Q8DJ85          6 HCR--IIELPKI----SDP-RGNLTFIEAN-RH--IPFEIRRVYYLYDVPGGAARGGHAHKALHQFIVAMSGSFDVILDD 75  Synechococcus ...
Q1GLS2          5 KCR--IIDLPRI----ADA-RGNLTFIEGQ-NH--IPFDIKRVYYLYDVPGGSDRGEHAHKNLHQFMVCMSGSFDVCLDD 74  Ruegeria sp. T...
jgi:Dole_1289   5 KCQ--IIHLPRI----NDP-RGNLTFVEAG-RH--IPFSIQRVYYLYDVPGGAERGGHAHKELHQLIIAMSGSFDIHLDD 74  Desulfococcus ...
jgi:Gura_3191   5 DCK--ITDLPKI----TDP-RGNLTFIEGEgRH--IPFDIKRVYYLYDVPGGAERGGHGHKALHQLIIAMSGSFDVVLDD 75  Geobacter uran...
WP_013185801   10 DVT--FLDIPKI----IDP-RGNLAVIEQQ-T---IPFSHKRVYYLFDVPEGAKRGGHSHIEQSEVLIALNGSFTVIVDD 78  Croceibacter a...
4MZU_D        244 GENR-EEYVLDSIDKGIYLPPMTWGVQYKYSKDAVLLVFASHYYDSDDYIRDYSTFKQMR 302 Shewanella denitrificans OS217
wustl:BD3538   74 GIRQ-QTFLLNRSYYGLYVPKGAWREMVNFSTNSLALVLASIPYSVDDYIYDYQEFKNYT 132 Parabacteroides distasonis ATCC 8503
Q8F5R6         79 GRNK-KEIVLNNSSIGLLIPAGLWNTIIFNQLESVIAVFCDRIYEEDDYLRDPAEFLIYK 137 Leptospira interrogans
Q11S51         75 IRGEkELFQLHAPSMGLFVPVMHWRRI-RLSKGAVLLCLASHDFEETDYIRSYNDFAAYK 133 Cytophaga hutchinsonii ATCC 33406
Q2WBB6         75 GKGR-HALTLDHPAKALLVPPGIWAEQTYGGPEAVLLVLCDRVYEEDDYIRDYNDFITYR 133 Magnetospirillum magneticum AMB-1
Q8DJ85         76 GSQK-KRFHLNRSYYGLYICPMIWRELDNFSSGAVCTVLASDFYDESDYYRDYGAYLTAL 134 Synechococcus elongatus
Q1GLS2         75 GFES-KRIQLNRSYFGIYICPMIWRYLDNFSSGAVCMVLASEPYDEADYIRDRDEYLRAV 133 Ruegeria sp. TM1040
jgi:Dole_1289  75 GRSK-KSVHMNRSYYGLYVCPMIWREIDNFSSGAVCMVLASNYYDEADYYRDYHQFIDVV 133 Desulfococcus oleovorans Hxd3
jgi:Gura_3191  76 GNEK-KRFHLNRSYYGLYVRPMIWRELDNFSSGSVCMVLASNLYDEEDYYRDYESFIKAV 134 Geobacter uraniireducens Rf4
WP_013185801   79 GEDK-KRVTLDNPLKGLLIPNGIWRELEDFTKGSVCLVLASDIFEEADYIREYTDFKSSK 137 Croceibacter atlanticus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap