Conserved Protein Domain Family
MAGP

?
pfam05507: MAGP 
Microfibril-associated glycoprotein (MAGP)
This family consists of several mammalian microfibril-associated glycoprotein (MAGP) 1 and 2 proteins. MAGP1 and 2 are components of elastic fibers. MAGP-1 has been proposed to bind a C-terminal region of tropoelastin, the soluble precursor of elastin. MAGP-2 was found to interact with fibrillin-1 and -2, as well as fibulin-1, another component of elastic fibers this suggests that MAGP-2 may be important in the assembly of microfibrils.
Statistics
?
PSSM-Id: 398907
Aligned: 11 rows
Threshold Bit Score: 123.479
Threshold Setting Gi: 126686
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P27424         1 MRA----ASLFLLFLPAG---LLA-QGQydlDPLppypdhvqythys--eqienpdyydypEMT--------PRPPEeqf 62  cattle
1_pfamImport   1 LTGpkvlLYLTVLIIPSD---NKM-FSDlffHSD---------------------------DVT--------PVTPE--- 38 
2_pfamImport   1 LLGpkvlLFLTALIISSDwtpLGV-SGQ---EG-------------------------------------------R--- 30 
4_pfamImport   1 LLGpkvlLFLTVLIVPSEwipLWV-NGQ---RGD---------------------------DVT--------QVTQE--- 38 
Q13361         3 LLGpkvlLFLAAFIITSDwipLGV-NSQ---RGD---------------------------DVT--------QATPE--- 40  human
XP_012406157   4 L-GskllLCLIALFISSDwilLGI-NGQ---RGD--------------------------------------ETTQE--- 37  Tasmanian devil
XP_005996362   1 ----mrtVCLFLLYLPAL---LKAqQQQydlDEifyneqaqysqydsqfgnsqynpdfdypDAT--------LNNLDntg 65  coelacanth
XP_007656951   1 MRT----AYLFLLCLPAG---LLA-QGQydiEPppypdqgqysqyn---dhienpdyydyqEVT--------RQPPEeqf 61  platypus
3_pfamImport   1 MRV----AYLFLLVLPAG---LLA-QGQydlDPLppfpdhvqythys--dqidppdyydyqGKGlgqlgwgyPRDPRegv 70 
Q9QZJ6         3 FLGqkalLLVLAISIPSDwlpLGV-SGQ---RGD---------------------------DV------------PE--- 36  house mouse
Q28022         3 FFGpkvlLLLTALIMSSGrtpLGV-SGQ---RGD---------------------------DVT--------TVTSE--- 40  cattle
P27424        63 qfqsqqqvqqEVIPAP---TLEPGTVEtepT--------EPGPLD------------CREEQYPCTRLYSIHKPCKQCLN 119 cattle
1_pfamImport  39 ----------TFTEDPn-lVNEPSTDE---TafsvladiEPSTDDlgefslcwtssdCRDEKFACTRLYSVHRPVKQCIH 104
2_pfamImport  31 ----------CVTTGWeigSNSPPSSHllfCafsaladiVPSTDDlgeilniqasseCRDEKFACTRLYSVHRPVKQCVH 100
4_pfamImport  39 ----------TFTDDPn-lVNDPPTDE---TafsvladvEPSIDDlassndkntttgCWSHIL---RVASLNPPRLNCIR 101
Q13361        41 ----------TFTEDPn-lVNDPATDE---TvlavladiAPSTDDlaslseknttaeCWDEKFTCTRLYSVHRPVKQCIH 106 human
XP_012406157  38 ----------TFTDDPnlmVNDPPTDD---Tvlv---dvVPSMDDqaissdknasaeCREEQFPCTRLYSVHRPVKQCIH 101 Tasmanian devil
XP_005996362  66 ysqsqlqvqqQIIPAP---TTDGIFDEtepT--------EPGPLD------------CREEQYPCTRLYSVHKPCRQCLK 122 coelacanth
XP_007656951  62 qyqsqqqvqqEVIQPP-----TPENPEtepT--------EPGPLD------------CREEQYPCTRLYSVHKPCKQCLN 116 platypus
3_pfamImport  71 d------pyqLLLSPPl-lTPEPGHPEtepT--------EPGPLD------------CREEQYPCTRLYSIHKPCKQCLH 123
Q9QZJ6        37 ----------TFTDDPn-lVNDPSTDD---Tala---diTPSTDDlagdk--nataeCRDEKFACTRLYSVHRPVRQCVH 97  house mouse
Q28022        41 ----------TFTEDPn-lVNDPATDE---Tvla---diQPSTDDlaslndknttteCRDEKFACTRLYSVHRPIKQCLH 103 cattle
P27424       120 EVCFYSLRRVYVVNKEICVRTVCAQEELLRAD 151 cattle
1_pfamImport 105 QLCFTSLRRMYIINNEICSRLVCKEHEVMKDE 136
2_pfamImport 101 QLCFTSLRRMYIINNEICSRLVCKEHEAMKDE 132
4_pfamImport 102 KTFFLNLRRMYIINNEICSRLVCKEHEAMKDE 133
Q13361       107 QLCFTSLRRMYIVNKEICSRLVCKEHEAMKDE 138 human
XP_012406157 102 QLCIVNVRRMYIINKEICTRLICKEHEVMKDE 133 Tasmanian devil
XP_005996362 123 SLCFYSLRRVYVINKEVCIRTVCAHEELLRAD 154 coelacanth
XP_007656951 117 QICFYSLRRIYVINKEICVRTVCAHEELLRAD 148 platypus
3_pfamImport 124 EVCFYSLRRMYIINKEICVRTVCAHEELLRAD 155
Q9QZJ6        98 QSCFTSLRRMYIINNEICSRLVCKEHEAMKDE 129 house mouse
Q28022       104 QICFTSSRRMYVINNEICSRLVCKEHEAMKDE 135 cattle
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap