6EHL


Conserved Protein Domain Family
Ebola_NP

?
pfam05505: Ebola_NP 
Ebola nucleoprotein
This family consists of Ebola and Marburg virus nucleoproteins. These proteins are responsible for encapsidation of genomic RNA. It has been found that nucleoprotein DNA vaccines can offer protection from the virus.
Statistics
?
PSSM-Id: 398905
Aligned: 3 rows
Threshold Bit Score: 1115.2
Threshold Setting Gi: 166215051
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6EHL_A  19 MDYHKILTAGLSVQQGIVRQRVIPVYQVNNLEEICQLIIQAFEAGVDFQESADSFLLMLCLHHAYQGDYKLFLESGAVKY 98 
P27588   1 MDLHSLLELGTKPTAPHVRNKKVILFDTNHQVSICNQIIDAINSGIDLGDLLEGGLLTLCVEHYYNSDKDKFNTSPVAKY 80  Marburg virus - Musok...
P18272  19 MDYHKILTAGLSVQQGIVRQRVIPVYQVNNLEEICQLIIQAFEAGVDFQESADSFLLMLCLHHAYQGDYKLFLESGAVKY 98  Ebola virus - Mayinga...
6EHL_A  99 LEGHGFRFEVKKRDGVKRLEELLPAVSSGKNIKRTLAAMPEEETTEANAGQFLSFASLFLPKLVVGEKACLEKVQRQIQV 178
P27588  81 LRDAGYEFDVIKNADATRFLDVSPNEPHYSPLILALKTLESTESQRGRIGLFLSFCSLFLPKLVVGDRASIEKALRQVTV 160 Marburg virus - Musok...
P18272  99 LEGHGFRFEVKKRDGVKRLEELLPAVSSGKNIKRTLAAMPEEETTEANAGQFLSFASLFLPKLVVGEKACLEKVQRQIQV 178 Ebola virus - Mayinga...
6EHL_A 179 HAEQGLIQYPTAWQSVGHMMVIFRLMRTNFLIKFLLIHQGMHMVAGHDANDAVISNSVAQARFSGLLIVKTVLDHILQKT 258
P27588 161 HQEQGIVTYPNHWLTTGHMKVIFGILRSSFILKFVLIHQGVNLVTGHDAYDSIISNSVGQTRFSGLLIVKTVLEFILQKT 240 Marburg virus - Musok...
P18272 179 HAEQGLIQYPTAWQSVGHMMVIFRLMRTNFLIKFLLIHQGMHMVAGHDANDAVISNSVAQARFSGLLIVKTVLDHILQKT 258 Ebola virus - Mayinga...
6EHL_A 259 ERGVRLHPLARTAKVKNEVNSFKAALSSLAKHGEYAPFARLLNLSGVNNLEHGLFPQLSAIALGVATAHGSTLAGVNVGE 338
P27588 241 DSGVTLHPLVRTSKVKNEVASFKQALSNLARHGEYAPFARVLNLSGINNLEHGLYPQLSAIALGVATAHGSTLAGVNVGE 320 Marburg virus - Musok...
P18272 259 ERGVRLHPLARTAKVKNEVNSFKAALSSLAKHGEYAPFARLLNLSGVNNLEHGLFPQLSAIALGVATAHGSTLAGVNVGE 338 Ebola virus - Mayinga...
6EHL_A 339 QYQQLREAATEAEKQLQQYAESRELDHLGLDDQEKKILMNFHQKKNEISFQQTNAMVTLRKERLAKLTEAIT-------- 410
P27588 321 QYQQLREAAHDAEVKLQRRHEHQEIQAIAEDDEERKILEQFHLQKTEITHSQTLAVLSQKREKLARLAAEIEnnivedqg 400 Marburg virus - Musok...
P18272 339 QYQQLREAATEAEKQLQQYAESRELDHLGLDDQEKKILMNFHQKKNEISFQQTNAMVTLRKERLAKLTEAIT-------- 410 Ebola virus - Mayinga...
6EHL_A 411 -AASLPKTSGHYDDDddiPFPGPINDDDNPGhqdddptdSQDTTIPDVVVDPDDGSYGEYQSYSENGMNAPDDLVL-FDL 488
P27588 401 fKQSQNRVSQSFLND---PTPVEVTVQARPM--------NRPTALPPPVDDKIEHESTEDSSSSSSFVDLNDPFALlNED 469 Marburg virus - Musok...
P18272 411 -AASLPKTSGHYDDDddiPFPGPINDDDNPGhqdddptdSQDTTIPDVVVDPDDGSYGEYQSYSENGMNAPDDLVLfDLD 489 Ebola virus - Mayinga...
6EHL_A 489 DEDdEDTKPVPNrstkggqqknsqkgqhiegrqTQSRPIQNVPGPHRtihhASAPLTDNDRRNEpsgstsprmltpiNEE 568
P27588 470 EDTlDDSVMIPG---------------------TTSREFQGIPEPPR----QSQDLNNSQGKQE-------------DES 511 Marburg virus - Musok...
P18272 490 EDD-EDTKPVPNrstkggqqknsqkgqhiegrqTQSRPIQNVPGPHRtihhASAPLTDNDRRNEpsgstsprmltpiNEE 568 Ebola virus - Mayinga...
6EHL_A 569 ADPLDDADDETSSLPPLESDDEEQ---------DRDGTSNRTPTVAPPAPVYRDHSEKKEL------PQDE-----QQDQ 628
P27588 512 TNRIKKQFLRYQELPPVQEDDESEyttdsqesiDQPGSDNEQGVDLPPPPLYAQEKRQDPIqhpaanPQDPfgsigDVNG 591 Marburg virus - Musok...
P18272 569 ADPLDDADDETSSLPPLESDDEEQ---------DRDGTSNRTPTVAPPAPVYRDHSEKKEL------PQDE-----QQDQ 628 Ebola virus - Mayinga...
6EHL_A 629 DHTQEARNQDSDNT-QSEHSFEEMYRhilrsqgpfdavLYYHMMKDE------PVVFSTSDGKEYTYPDSLEEEYPPWLT 701
P27588 592 DILEPIRSPSSPSApQEDTRMREAYE------------LSPDFTNDEdnqqnwPQRVVTKKGRTFLYPNDLLQTNPPESL 659 Marburg virus - Musok...
P18272 629 DHTQEARNQDSDNT-QSEHSFEEMYRhilrsqgpfdavLYYHMMKDE------PVVFSTSDGKEYTYPDSLEEEYPPWLT 701 Ebola virus - Mayinga...
6EHL_A 702 EKEAMNEENRFVTLDGQQFYWPVMNHKNKfMAI 734
P27588 660 ITALVEEYQNPVSAKELQADWPDMSFDER-RHV 691 Marburg virus - Musoke, Kenya, 1980
P18272 702 EKEAMNEENRFVTLDGQQFYWPVMNHKNKfMAI 734 Ebola virus - Mayinga, Zaire, 1976
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap