Conserved Protein Domain Family
SCP-1

?
pfam05483: SCP-1 
Synaptonemal complex protein 1 (SCP-1)
Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex. Synaptonemal complexes are structures that are formed between homologous chromosomes during meiotic prophase.
Statistics
?
PSSM-Id: 114219
View PSSM: pfam05483
Aligned: 2 rows
Threshold Bit Score: 1050.85
Threshold Setting Gi: 209572682
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q03410  28 AGGDSNYFKTVNKCTEGDFGVPLTMSSLSKNRENIDTDPAFQKLSILPMLEQVANSgSCHYQEGVNDSDFENSEPMSRLY 107  Norway rat
Q15431  28 LGGDSTFFKSFNKCTEDDFEFPFAKTNLSKNGENIDSDPALQKVNFLPVLEQVGNS-DCHYQEGLKDSDLENSEGLSRVY 106  human
Q03410 108 SKLYKEAEKIKKWKVSIESELKQKENKLQENRKIIEAQRKAIQELQFENEKVSLKLEEEIQENKDLIKENNATRHWCNLL 187  Norway rat
Q15431 107 SKLYKEAEKIKKWKVSTEAELRQKESKLQENRKIIEAQRKAIQELQFGNEKVSLKLEEGIQENKDLIKENNATRHLCNLL 186  human
Q03410 188 KETCARSAEKTSKYEYEREETRQVYVDLNNNIEKMILAFEELRVQAENARLEMHFKLKEDHEKIQHLEEEYQKEVNNKEN 267  Norway rat
Q15431 187 KETCARSAEKTKKYEYEREETRQVYMDLNNNIEKMITAFEELRVQAENSRLEMHFKLKEDYEKIQHLEQEYKKEINDKEK 266  human
Q03410 268 QVSLLLIQSTEKENKMKDLTFLLEESRDKANQLEEKTKLQDENLKELNEKKDHLTSELEDIKMSMQRSMSTQKTLEEDLQ 347  Norway rat
Q15431 267 QVSLLLIQITEKENKMKDLTFLLEESRDKVNQLEEKTKLQSENLKQSIEKQHHLTKELEDIKVSLQRSVSTQKALEEDLQ 346  human
Q03410 348 IATKTIYQLTEEKEAQMEELNKAKTTHSLVVTELKATTCTLEELLRTEQQRLENNEDQLKLITMELQKKSSELEEMTKFK 427  Norway rat
Q15431 347 IATKTICQLTEEKETQMEESNKARAAHSFVVTEFETTVCSLEELLRTEQQRLEKNEDQLKILTMELQKKSSELEEMTKLT 426  human
Q03410 428 NNKEVELEELKTILAEDQKLLDEKKQVEKLAEELQGKEQELTFLLQTREKEIHDLEVQVTVTKTSEEHYLKQVEEMKTEL 507  Norway rat
Q15431 427 NNKEVELEELKKVLGEKETLLYENKQFEKIAEELKGTEQELIGLLQAREKEVHDLEIQLTAITTSEQYYSKEVKDLKTEL 506  human
Q03410 508 EKEKLKNIELTANSDMLLLENKKLVQEASDMVLELKKHQEDIINCKKQEERMLKQIETLEEKEMNLRDELESVRKEFIQQ 587  Norway rat
Q15431 507 ENEKLKNTELTSHCNKLSLENKELTQETSDMTLELKNQQEDINNNKKQEERMLKQIENLQETETQLRNELEYVREELKQK 586  human
Q03410 588 GDEVKCKLDKSEENarsieyevlkkekqmkilenkCNNLKKQIENKSKNIEELHQENKALKKKSSAENKQLNAYEIKVNK 667  Norway rat
Q15431 587 RDEVKCKLDKSEEN---------------------CNNLRKQVENKNKYIEELQQENKALKKKGTAESKQLNVYEIKVNK 645  human
Q03410 668 LELELASTKQKFEEMINNYQKEIEIKKISEEKLLGEVEKAKATVDEAVKLQKEIDLRCQHKIAEMVALMEKHKHQYDKIV 747  Norway rat
Q15431 646 LELELESAKQKFGEITDTYQKEIEDKKISEENLLEEVEKAKVIADEAVKLQKEIDKRCQHKIAEMVALMEKHKHQYDKII 725  human
Q03410 748 EERDSELGLYKNREQEQSSAKVALETELSNIRNELVSLKKQLEVEKEEKEKLKME-QENTAILTDKK 813  Norway rat
Q15431 726 EERDSELGLYKSKEQEQSSLRASLEIELSNLKAELLSVKKQLEIEREEKEKLKREaKENTATLKEKK 792  human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap