Conserved Protein Domain Family
PsaN

?
pfam05479: PsaN 
Photosystem I reaction centre subunit N (PSAN or PSI-N)
This family contains several Photosystem I reaction centre subunit N (PSI-N) proteins. The protein has no known function although it is localized in the thylakoid lumen. PSI-N is a small extrinsic subunit at the lumen side and is very likely involved in the docking of plastocyanin.
Statistics
?
PSSM-Id: 398889
Aligned: 7 rows
Threshold Bit Score: 134.618
Threshold Setting Gi: 226516080
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002953671       3 VAMRAQCAKVQAArpar---attVVCRASAQSRRELLGLGVLLGAAALAPA--ANAGVVEDLLAKSAANKALNNKKRLAT 77  Volvox cart...
XP_006842392      47 MSVRAQASAVSLD----------KEEKCAGGRRAAMLCLAAALFATTTVAAtdANAGVIDDYLEKSKLNKELNDKKRLAT 116 Amborella t...
P49107            45 PVIKAQRVVGDDV-------------DGSNGRRSAMVFLAATLFSTAAVSAs-ANAGVIDEYLERSKTNKELNDKKRLAT 110 thale cress
EEF35750          43 PVIRAQRAKPASD-------------SKADGRRAAMLCLAATLFTTAAAVSs-ANAGVIEEYLEKSKANKELNDKKRLAT 108 castor bean
jgi:MICPUN_93625  23 KATAAKASKAQGA-----------VCFFGDAKKAAAATLAAAVLVAGPAMP--AKADLTSDLLARTEANKELNDKKRAAT 89  Micromonas ...
AQK39857          11 aAAAAQANTAAASspmkqqvqvaP-----EGRRAALLGLAAVLAVTATTAGs-AKAGVFDEYLEKSKANKELNDKKRMAT 84  Zea mays
VAH26650          69 AAAVPQSASPAAAkrv----qvaP----AKDRRSALLGLAAVFAVTAASAGs-ARASVFDEYLEKSKLNKELNDKKRAAT 139 durum wheat
XP_002953671      78 SYANLARSRTVYDGTCQFPENFFGCEELAFNKGVKYIAEDLKIECEG-KDAKSCGSKFTLRS 138 Volvox carteri f. nagariensis
XP_006842392     117 SGANFARAYTVEFGTCKFPENFTGCHDLAKQKKVPFLTDDLQLECEG-KDKFKCGSNVFWKW 177 Amborella trichopoda
P49107           111 SGANFARAFTVQFGSCKFPENFTGCQDLAKQKKVPFISEDIALECEG-KDKYKCGSNVFWKW 171 thale cress
EEF35750         109 SGANFARAYTVQFGTCKFPENFTGCQDLAKQKKVPFISDDLALECEG-KDKYKCGSNVFWKW 169 castor bean
jgi:MICPUN_93625  90 SSANFERSRTVTDGVCKFPQNMLGCEIASSTGDVAFLSADKALECEGtRDGKVCASKapgsf 151 Micromonas commoda
AQK39857          85 SAANFARAYTVEFGSCQFPYNFTGCQDLAKQKKVPFLSDDLEIECEG-KEKFKCGSNVFWKW 145 Zea mays
VAH26650         140 SGANFARAYTVQFGSCKFPYNFTGCQDLAKQKKVPFITDDLEIECEG-KEKFKCGSNVFWKW 200 durum wheat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap