Conserved Protein Domain Family
SURF2

?
pfam05477: SURF2 
Surfeit locus protein 2 (SURF2)
Surfeit locus protein 2 is part of a group of at least six sequence unrelated genes (Surf-1 to Surf-6). The six Surfeit genes have been classified as housekeeping genes, being expressed in all tissue types tested and not containing a TATA box in their promoter region. The exact function of SURF2 is unknown.
Statistics
?
PSSM-Id: 398887
Aligned: 23 rows
Threshold Bit Score: 204.905
Threshold Setting Gi: 356559663
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
NP_001039294   9 PEEVRLFLRQQPLLSLVESG-------KVRCRLTGHELPCRLAELQAYTDGRKYRRLiKTSREFDYGTFEPHIVPSTKNI 81  chicken
4_pfamImport   1 EPAIQQLLNQHEFLEVIETGqdenkrvRVKCQLTQHEMLLHADVIATHLASKKFRKA-RDWYCHDYSQYEPYIVPHRRLP 79 
XP_004231834  16 TGKEGYKLLGNPTFKKLENG-------RFKCVQTGHELPEH--ARDSYAHSKHCR---LGLIDAALSKNKPPLNMFNQDP 83  tomato
XP_006338633  16 TGKEGYKLLGNPTFKKLENG-------RFKCVQTGHELPEH--ARDSYAHSKHCR---LGLIDAALSKNKPPLNMFNQDP 83  potato
XP_002521492   8 ESKEGNKLLGSPTFTELENG-------RFKCVETGHEMLAK--DKDSYSQSKRCR---LGLIDFALANSKPPLNMFKQDP 75  castor bean
3_pfamImport   1 AADLRAFLLNHPFLQLTDSK-------KIKCTLNGHEMPCSLTELQNFTKGKKYVTL-SAAAEFNYSQYEPHVVPSSKQP 72 
XP_005803809   5 PADIRTFLTDHPFFQLTDGK-------KIKCTLNGHELPCSLAELRSFIQGKKYKKL-NAEAEFNYSQYEPHIVSSTKQP 76  southern platyfish
O57589         5 PVDLKAFLLNHPFLQLTDGK-------KIKCTLNGHEFPCNLQELEKFTQGKKYEKL-RPAADFNYRQYEPHIVASTKQP 76  torafugu
XP_004074800   5 PADLRAFLVTQPFFELTDNK-------KIKCTLNGHELPCNLTELQNFTEGKKYKKL-SSRAEFNYSQYEPHIIPSTKQP 76  Japanese medaka
XP_003445225   5 PADLREFLLNHPFLQLTGGK-------KIKCTLNGHEFPCKLAELQKFTEGKKYEKL-SAAAEFNYSQYEPHIVPSTKQP 76  Nile tilapia
NP_001039294  82 ---HQLFCKLTLRHINKLPEHVLRHVQGKRYQKALKTYE-KCQKEGVKYVPACLRQKQQRRqhaDDQMDGSRQP------ 151 chicken
4_pfamImport  80 ---KSLFCNVTSTILNRIPAEVVKHVQGKRYKRMKEHVKvQVIKTGNNGDDDQTLSNRDFD---ADLFEFENSQvvysde 153
XP_004231834  84 lnrSKLICKLTGDTVNKSEEHIWKHMSGKRFLRMLEKKE-TETEMENGGLEKQVENEAAKK---TDSKANRRDKk----- 154 tomato
XP_006338633  84 lnrSKLICKLTGDTVNKSEEHIWKHMSGKRFLRMLEKKE-TETEMENGGLEKQVENGVAKK---TDSKANRRDKk----- 154 potato
XP_002521492  76 asrSKLICKLTGDTVNKSEEHIWKHINGKRFLNKLEQKE-MGKVEDKQKEDSKSSADGPKK--------KKKKT------ 140 castor bean
3_pfamImport  73 ---KQLFCKLTLRHLNRQPHHVLRHVNGKRFKKALCKYE-ECVKQGIEFVPAALKQKRPKG---TREDPRERPS------ 139
XP_005803809  77 ---NRLFCKLTLRHLNRQSDHVLRHVSGKRFKKALSQYE-ECTRQGIEFVPARLKQKKPKN---TGEEMSQSSK------ 143 southern platyfish
O57589        77 ---NQLFCKLTLRHLNRQPHHVLRHIHGKRFKKALSKYE-DCVQKGIEFIPARLMQKRPKD---AREEVSRGRTs----- 144 torafugu
XP_004074800  77 ---NQLFCKLTLRHLNREPRHVLIHINGKRFKKALAQYE-ECVKQGIEFVPERLKHKKPKD---TDVDFSRGMSs----- 144 Japanese medaka
XP_003445225  77 ---NQLFCKLTLRHLNRQPHHVLRHVNGKRFKKALSKYE-ECVKQGIEFVPTRLTQKKPRD---TEEEGGRGNSs----- 144 Nile tilapia
NP_001039294 152 --HRTEEFWEPNSprtDEDEDGeeTDDSMSDLYPPGLFPEKSPAAPQNTEAND-----GFAT-DSEDDGAKLSRENSdVN 223 chicken
4_pfamImport 154 deEQGDGEDEGDEletVKKASLqeEDDDMADLYPDDESNEGSDTKAIDTDTKA-----DDDT-DETME------------ 215
XP_004231834 155 --KNKKKEIEDASk-vISEIRD--SSGKNSGSEDDDEFWMPPVGARWDNDDGGdrwgsGSES-EEEEEDAIGQDGGTeEE 228 tomato
XP_006338633 155 --KNKKKEIEDASk-vISEIRD--SSGKNSGSEDDDEFWMPPVGARWDNDDGGdrwgsGSESeEEEEEDAIGQDGGTeED 229 potato
XP_002521492 141 --KKKEKEEKPIEe-iISEVRD--SSDKDSDTEELD-FWMPPVGERWDFDDGGdrwgsDGEL-EQETEKENGADDAVdEN 213 castor bean
3_pfamImport 140 --NQGSKSWEPSSs--DDDQSD--SEDSMSDLYPPTMFTLKNQAEDATHCVDNea-edNFKT-DEEEE------------ 199
XP_005803809 144 --RRPNGVWEPSSs--GEEHSD--SEDSMSDLYPSSMFSLKNPEVETTAGGENeeeehDFQT-DEDEE------------ 204 southern platyfish
O57589       145 --KQGNGTWAPSS---SEEDGD--SEDSMSDLYPSHLFTLKSPTEATTGGDGNqe-edDFHT-DDGED------------ 203 torafugu
XP_004074800 145 --KHSSSMWEHSSs-dDDGHSD--SEDSMSDLYPSSMFTLKNVAEESMEVKGEee--dEFQT-DEEME------------ 204 Japanese medaka
XP_003445225 145 --KHSSSTWEHSSs--DDGHSD--SEDSMSDLYPPSMFTLKNQAEESMEDGREee-edDFQT-DEDEE------------ 204 Nile tilapia
NP_001039294 224 GDGGRMEVSRAAGKRGKKQSGPSKKKFKS-CHQK 256 chicken
4_pfamImport 216 -------EKPQKKRRAKSSSGSKTTRHRSkKVKM 242
XP_004231834 229 NHDTGEL--SKRAKRMSLEIGPSSFASRK---KK 257 tomato
XP_006338633 230 NHDAGEL--SKRAKRMSLEIGPSSFASRK---KK 258 potato
XP_002521492 214 GKESEEL--SKRTKRMSIEIGPSSFASKK---KK 242 castor bean
3_pfamImport 200 ----MEVESQGLQKRKKVQGGGFQKKFRNnNYKN 229
XP_005803809 205 ----MEVDTQVVQKRKKVQGGGFQKKFRNnRWKS 234 southern platyfish
O57589       204 ----MEVDTPALQKRKKAQGGGTQKKFRNnHWKS 233 torafugu
XP_004074800 205 --------EQVVQKRKKVQSGGFQKKFRNnQWKS 230 Japanese medaka
XP_003445225 205 ----MEVEKQAVQKRKKVQGGGFHKKQRNnSWRS 234 Nile tilapia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap