4XR0


Conserved Protein Domain Family
Ter

?
pfam05472: Ter 
DNA replicatioN-terminus site-binding protein (Ter protein)
This family contains several bacterial Ter proteins. The Ter protein specifically binds to DNA replicatioN-terminus sites on the host and plasmid genome and then blocks progress of the DNA replication fork.
Statistics
?
PSSM-Id: 398886
Aligned: 21 rows
Threshold Bit Score: 331.578
Threshold Setting Gi: 399160370
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4XR0_A        16 RLNTTFRQMEQELAIFAAHLEQH--KLLVARVFSLPEVKKEDEHNPLNRIEV-KQHLGNDAQSLALRHFRHLFIQQQSEN 92 
WP_010845864   9 SLTTCFKKQEEKLSELIGLLVNY--PLIDARIFELPQIEKGEEHDQITEIQV-NPLEGNEALNLGLHFYQKLFIHHNNPN 85  Xenorhabdus nem...
Q7N4I1         9 DLNSCFQQQESKLKQLYEQLNSY--SLLAAHVFILPDVEKGCEHEPVTEIIV-NEMTGNDARNIGLSHYQKLFIYHNNQN 85  Photorhabdus la...
CAR42752       9 RFNLCFQQLETEINALTDFLRQL--KQLPSAVFELPEVSKEDEHDEITNVTV-SPSYDLDALELSLKLMTNLFIYDNAPH 85  Proteus mirabil...
WP_015871384   9 RLHLCFRQLEEALDHTDHQLAAL--TPLQAQIFALPEIEKGKEHEEIRRIRV-TPCAAGEAFDAGRSHFRRLFLHHHRQH 85  Edwardsiella ic...
CCH:MU9_2244   3 sLTDCFNQLESALNTLCKAIRLH--PSRTAEVYQLPEILKGEENNTVNTISV-IPVSGEGAVSLALSHYQRLFIFDNDQE 79  Morganella morg...
WP_014292561   7 ELRHTMSLLESALAALNREILRQagDLPVATCYCLPEVALGKEHEPVEHIQVqAQLTGRPALDAALSAFGRWHLK---AD 83  Oceanimonas sp....
Q3ICK8         6 QIRSQFDLMSELTLRLIEELNLC--EYTKAEYYQLPDISTVDEDKVAESIKV-TKISGELAHKAILNSFTDIYKK---QG 79  Pseudoalteromon...
WP_001097010   5 fISEQFSAMCRDLTNLSSLIKRL--PPRYAKVAAIPPTGKGMENEPVNKIVV-TEQTGREALELAAHSYRDLHIN---PD 78  Gammaproteobact...
Q2NSY7         9 RLNTCFNTLQLRLTALEPLLSDF--RLLAARVFTLPEVEKGQEQDEITTLTV-EQQVGKTALATGVAHFQRLFIYQQNQN 85  Sodalis glossin...
4XR0_A        93 RSSKAAVRLPGVLCYQVDNLSQA-ALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLITLNAYRTLTVL-H 170
WP_010845864  86 ISSKSASRLPGAICFSVSHQQYK-EAMNLINEVNQLKAELENIVTKESGVSKEQRFEFVHNHLRGLITLNAYRTITPL-L 163 Xenorhabdus nem...
Q7N4I1        86 ISSKAAVRLPGVLCFSVNQQQYR-SALLLIEEINKLKAELEHIVTVQSGVDKEQRFEFVHSQLHGLITLNAYRTITPL-L 163 Photorhabdus la...
CAR42752      86 VSSKRAIRLPGVLCFSVSNPVFK-NVKTQVESINSLKKQLSDIVTKESGISKEERFDFVHNQLKGLITLNAYRTLTLL-S 163 Proteus mirabil...
WP_015871384  86 VSSKAAVRLPGVLCYQATPPQRA-ALRDAIERVNRHKRQLEQIIAVETGLPPEQRFEFVHRQLKGLLTLSAYRTLTLL-D 163 Edwardsiella ic...
CCH:MU9_2244  80 ISSKSAIRLPGVLLITLSPAQRK-IMQQQLNEVNRLKQQLASIVTETSGVDKTQRFEFVHNQIKGLITLNAYRQIQSV-T 157 Morganella morg...
WP_014292561  84 CSAKASFRLPGFILL--PGASRA-LLEQQVAEVNRLKLAFRTLVQQLDD--KDKKFTLVHHTFPGLITLQVYRQLTLLpH 158 Oceanimonas sp....
Q3ICK8        80 LSSRVLKRHPGLLVI--KNADKQ-ALINRIAQVNKAKAAFKECILAIDN--NDARFEAVHNAVPNLITLAAYRKIHSEhE 154 Pseudoalteromon...
WP_001097010  79 YSQKSARRTVGVLWFSPSRIGVAdEIAATVERINAAKAGIEEFIISTYP-TRQERFEALRADCPGVMTLHLYRQIRCY-T 156 Gammaproteobact...
Q2NSY7        86 SSSKAAIRLPGALCFAVDNDQYA-AAVSLISEINDLKTHLSRLITVESQLPPEQRFDFVHRHLRGLKTLSAYRGLQVI-S 163 Sodalis glossin...
4XR0_A       171 DP--ATLRFGWANKHIIKNLHRDEVLAQLEK--SLKSPRSVAPWTREEWQRKLEREYQDIAALPQNAKLKIKRPVKVQPI 246
WP_010845864 164 NP--DTINFGWANKNIINKVTKQQILDRLEK--SYKAGRAVPPYSNEQWAALVELEMTDIKKLPDDVVLKIKRPVKVQPI 239 Xenorhabdus nem...
Q7N4I1       164 NP--DSVRFGWANKNIINKVTKDQILQRLEK--SYNSGRAVSPYSREQWAALVAKEIIDIKKLPDDVVLKIKRPVKVQPI 239 Photorhabdus la...
CAR42752     164 DP--DTVRFGWANKNIIKNLTRNDVLAQLEK--SREANRAVPPYTSEQWAERIDKEIMTLSQLPENAKLKIKRPVKVQPI 239 Proteus mirabil...
WP_015871384 164 DP--SSVGFGWANKQVINNLSRAEVLTRLDK--SLRAGRAVAPYTREQWAQHILQERDTLMALPENVRLKIRRPVKVQPI 239 Edwardsiella ic...
CCH:MU9_2244 158 SP--SSVRFGWANKHIIQKVDRDTLLSQLEE--QYQNPRAIQSLTREERQVYLAKEISALKQVPEDAILKIKRPVKVQPI 233 Morganella morg...
WP_014292561 159 TA--SRLGFTWANKQIIQKVDKARLVEQLMQ--SRHSPPPLTD--AHTWQQCVDREIYDVKRLPAHVELRLRRPVKTHPM 232 Oceanimonas sp....
Q3ICK8       155 SP--FSVRFTWMHKHATKTLTKKMALEMLQKsaSYRNPRMID---QQKWQALVAQEQLRVASLGEKEKLRIRRPTRVSPQ 229 Pseudoalteromon...
WP_001097010 157 NGdiDSIRFTWQRKDSLKKPVKEELLQRIREelERSGP---------DYQLPLEQLIQKIASTPE-PYLRERREVKVQPV 226 Gammaproteobact...
Q2NSY7       164 DP--ATVRFGWANKQVIKNLTRKEVLTLLQK--SLHGGRAVPPYTREQWQERVREEINLVSKLPPDIPLKIKRPVKVQPI 239 Sodalis glossin...
4XR0_A       247 ARVWYKGDQ--KQVQHACPTPLIALINRDNgaGVPDVGELLNYDADNVQHRYKPQAQPLRLIIPRLHLY 313
WP_010845864 240 TRVWYSELQ--KQVQYACPLPVIVFYTEDNe-IKPRIGTLPDYNANAIKHRYKPKAKPLELVIPRLHLY 305 Xenorhabdus nematophila
Q7N4I1       240 ARVWYAEQQ--KQVQYACPLPIIAFYVNYGd-NQPKIGRLANYDANAIVHRYKPKAKPLELIIPRLHLY 305 Photorhabdus laumondii sub...
CAR42752     240 ARVWYSEQQ--KQVQYACPLPLLAFYIDKAsdFKPIIGELADYDVNNIQIRHRPKAKKLQLLIPRLHLY 306 Proteus mirabilis HI4320
WP_015871384 240 ARVWYSAIQ--RQVQHPCSMPLIALCESAE--SAPRIGTLADYDADNIAVRHRPRAKKLIPVIPRLHLY 304 Edwardsiella ictaluri
CCH:MU9_2244 234 ARVWYSEAQ--KQVQYACASPLIVFCDENE--EKPVTGVLPDYDAENIKIRHRPKAKKLIPVISRLYVY 298 Morganella morganii subsp....
WP_014292561 233 VNVRWSEPLtpRQQQFKAHLPLL-LCQDEL----PAITHLGDYP-PAKARKQRAARIGGEPLIPRLHIY 295 Oceanimonas sp. GK1
Q3ICK8       230 VNVRYTA-Q--NRYHVSAALPFILINPEPD----VKLGILPNYE----KPLSHPRKRDYDFLVDRLYLE 287 Pseudoalteromonas haloplan...
WP_001097010 227 ANVMAAGVL--KTV--TAPMPLIVLQDKDV-----QLKLLRNFDASEQRKTRSDKAA-----SEILGTF 281 Gammaproteobacteria
Q2NSY7       240 ARVWYQAQK--KQVQYACPSPLIVLCRTQKgaTAPMLGELLNYDRHTIRPKHVPAALPAHLLIERLHLY 306 Sodalis glossinidius str. ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap