Conserved Protein Domain Family
ApoL

?
pfam05461: ApoL 
Apolipoprotein L
Apo L belongs to the high density lipoprotein family that plays a central role in cholesterol transport. The cholesterol content of membranes is important in cellular processes such as modulating gene transcription and signal transduction both in the adult brain and during neurodevelopment. There are six apo L genes located in close proximity to each other on chromosome 22q12 in humans. 22q12 is a confirmed high-susceptibility locus for schizophrenia and close to the region associated with velocardiofacial syndrome that includes symptoms of schizophrenia.
Statistics
?
PSSM-Id: 398882
Aligned: 33 rows
Threshold Bit Score: 344.649
Threshold Setting Gi: 1126298523
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_007503451 166 LKQSQ-----LSEdEAWERF--FADSSSMREKATQLSETLYGLFGDKVLDDTNGqDGSLSDEDKIFLKEFPKKKMELEER 238 gray short-tail...
Q9BWW9        41 kspepefpslvnlcQSWKIN--NLMSTVHSDEAGMLSYFL--FEELMRCDKDSMpDGNLSEEEKLFLSYFPLHKFELEQN 116 human
XP_005625974  45 NMTREemhyiLFDaKAWEML--VQRSGLDRDEANILYHML--MEELMQNKEASM-LENLSEEEKIFLFWFPLQKNNLKKN 119 dog
XP_004743172  81 KVTREevydiLFHpEAWEMV--VARSGLDRDEADTLYHIL--MEELIRWKEVSM-PEDLSQEEKMFLLCFPLQKHKLEKS 155 domestic ferret
XP_001083469  19 RVSREnllqlLTDgRAWNEF--LVAAGLSRDEADVLRKALNKLVSHMVTKDKNR-HDKDQQHREWFLKEFPRLKKELEDH 95  Rhesus monkey
Q9BQE5        19 QVSREnllqlLTDdEAWNGF--VAAAELPRDEADELRKALNKLASHMVMKDKNR-HDKDQQHRQWFLKEFPRLKRELEDH 95  human
O95236        90 RVSPVhlqilLTNnEAWKRF--VTAAELPRDEADALYEALKKLRTYAAIEDEYV-QQKDEQFREWFLKEFPQVKRKIQES 166 human
Q9BPW4        46 KVSPVhlkilLTSdEAWKRF--VRVAELPREEADALYEALKNLTPYVAIEDKDM-QQKEQQFREWFLKEFPQIRWKIQES 122 human
XP_009008383  48 snssrrklilRTDsEAWQRFvaVAVAGLPRDEADALYEALKTLTTHEDIDDKDK-RQKDRQFREWFLKNFPQLRRDIQES 126 white-tufted-ea...
XP_019649268   1 -MTREemhyiLFHpEAWELM--VERSGLDRDEANTLHHIL--MEELIRQKEVSM-PGNLLEEEKMFLLCFPLQKYKLEKS 74  giant panda
XP_007503451 239 IQDLHAIADQVDKTHKKCIITNVVAGSTSIISSIVTIMGLALAPVTAGGSLILSASGFGLGALAAITSLSSSVIERVGNL 318 gray short-tail...
Q9BWW9       117 IKELNTLADQVDTTHELLTKTSLVASSSGAVSGVMNILGLALAPVTAGGSLMLSATGTGLGAAAAITNIVTNVLENRSNS 196 human
XP_005625974 120 IRELHALADQVDAKHKMLTKTSLVASSSGTVSGVMSILGFALAPVTVGGSLMLSAAGLGLGVAAVATNTLTSILERNSNS 199 dog
XP_004743172 156 IKELHAIADQVDVNHKMLTKTNLVASTSGTISGVLSLLGFALSPVTGGASLMLSTAGLGLGMTAAATSMLTSFLEDKNNS 235 domestic ferret
XP_001083469  96 IKMLRSLANQVQRIHRGTTITNVVANSISTTSGALSLLGLGLAPFSEGLSLLLMGTGAGLGAASAVTGITSSVVELVKQL 175 Rhesus monkey
Q9BQE5        96 IRKLRALAEEVEQVHRGTTIANVVSNSVGTTSGILTLLGLGLAPFTEGISFVLLDTGMGLGAAAAVAGITCSVVELVNKL 175 human
O95236       167 IEKLRALANGIEEVHRGCTISNVVSSSTGAASGIMSLAGLVLAPFTAGTSLALTAAGVGLGAASAVTGITTSIVEHSYTS 246 human
Q9BPW4       123 IERLRVIANEIEKVHRGCVIANVVSGST----GILSVIGVMLAPFTAGLSLSITAAGVGLGIASATAGIASSIVENTYTR 198 human
XP_009008383 127 IREIYALADRIEKVHRDSTISNVVSSATGTPSGIMSILGLVLAPFTGGTSLALTAARAGLGTLSVVARFITSAVEHSHTS 206 white-tufted-ea...
XP_019649268  75 IKELHAVADQLDATHKMLTKTRLVASSSGTISGVLSLLGLALAPVTVEGSLMLSVAGLGLGAAAAATNALTSIFESRSNx 154 giant panda
XP_007503451 319 TAKERVSNHKGT---KGQVAM--------------------VVLCKEAPQVVSVAQRCVslgnQVLEEINKNIRAFRLAK 375 gray short-tail...
Q9BWW9       197 AARDKASRLGPLttsH-------------------------EAFGGINWSEIEAAGFCVnkcvKAIQGI-KDLHAYQMAK 250 human
XP_005625974 200 AARDRASRLVPVpamTVH-----------------------DSSEERGCSEISAALLCIdkcvRAFKNL-KELRAYQMAK 255 dog
XP_004743172 236 TARERASKVIQMetpAAN-----------------------DTWEGIGFPKIGATLTCVdrfvQALHHV-KGLRAYQMAK 291 domestic ferret
XP_001083469 176 QARNQARSLDQSstdAVKVVK--------------------EFVGGNTPNFLTLVDSYS----TFTQRIGRDIRAIRQGR 231 Rhesus monkey
Q9BQE5       176 RARAQARNLDQSgtnVAKVMK--------------------EFVGGNTPNVLTLVDNWY----QVTQGIGRNIRAIRRAR 231 human
O95236       247 SAEAEASRLTATsidRLKVFK--------------------EVMRDITPNLLSLLNNYY----EATQTIGSEIRAIRQAR 302 human
Q9BPW4       199 SAELTASRLTATstdQLEALR--------------------DILRDITPNVLSFALDFD----EATKMIANDVHTLRRSK 254 human
XP_009008383 207 SAQAEASRLSGTsidKLKEFSelthemxpnsrscvtdfyiaTEV------------------------IGEQVRAMRGAR 262 white-tufted-ea...
XP_019649268 155 AARDRASGLVPMettMVY-----------------------EALEGIRLPEISAAWSCVvrcvGLLKNV-KELRACQMAK 210 giant panda
XP_007503451 376 ANTRLTTSAKTLMTTGSLSTRSARKVEKAFGGTALAMTKGSRMMSAMTTGAFVLVDMITVIHDLNHLLEGAKAEMAGELR 455 gray short-tail...
Q9BWW9       251 SNSGFMAMVKNFVAKRHIPFWTARGVQRAFEGTTLAMTNGAWVMGAAGAGFLLMKDMSSFLQSWKHLEDGARTETAEELR 330 human
XP_005625974 256 ANSGFMAKVNKFMAMGHIPFWRTGGLQRAVGASVMPMTKVARLLGAAGAGLSLMQDLRSLQQSWTHLEEGAKAETAEELR 335 dog
XP_004743172 292 VNSGFMAKVKDFIATGRVPFWRAGGQQTA---SALTMTRGARLLGAAGAGFLLMYDVKSLLENWKHLEDGARAETAEELR 368 domestic ferret
XP_001083469 232 VNPQLGAYGPPPQVIGRISVEGGEQVERVAEGPALAMSRGAMTVGAATGAILLLLDVVNTVYETKHLLQGAKSELAEELK 311 Rhesus monkey
Q9BQE5       232 ANPQLGAYAPPPHIIGRISAEGGEQVERVVEGPAQAMSRGTMIVGAATGGILLLLDVVSLAYESKHLLEGAKSESAEELK 311 human
O95236       303 ------ARARLPVTTWRISAGSGGQAERTIAGTTRAVSRGARILSATTSGIFLALDVVNLVYESKHLHEGAKSASAEELR 376 human
Q9BPW4       255 ------ATVGRPLIAWRYVPINVVETLRTRGAPTRIVRKVARNLGKATSGVLVVLDVVNLVQDSLDLHKGAKSESAESLR 328 human
XP_009008383 263 ASAQHP---------RQTSAQNGADLVLTSGPTNWLAGRGGRMVSTASTGILLVLEVVNLVYESKHLLEGANSQSAEQLR 333 white-tufted-ea...
XP_019649268 211 ASSGFMAKGNDFMDTRHVLFWRVGRLQTAVEGSALSMTKGARLLGAAGTGFLLMQDVRSLLHSWKHLKEGTRAETAEELR 290 giant panda
XP_007503451 456 EQAQELEGKLEELSQAYHSL 475 gray short-tailed opossum
Q9BWW9       331 ALAKKLEQELDRLTQHHRHL 350 human
XP_005625974 336 AVAGALEQELDQLTQRYELI 355 dog
XP_004743172 369 SAARELEQELKQLNMRYMQI 388 domestic ferret
XP_001083469 312 KQAQDLEGKLNVLIKIHEML 331 Rhesus monkey
Q9BQE5       312 KRAQELEGKLNFLTKIHEML 331 human
O95236       377 RQAQELEENLMELTQIYQRL 396 human
Q9BPW4       329 QWAQELEENLNELTHIHQSL 348 human
XP_009008383 334 QQAQMLEANLKVLSQLYrhl 353 white-tufted-ear marmoset
XP_019649268 291 TVAWKLEQELSQLTQHYrlt 310 giant panda
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap