6HAT,5ZB3


Conserved Protein Domain Family
Herpes_UL69

?
pfam05459: Herpes_UL69 
Click on image for an interactive view with Cn3D
Herpesvirus transcriptional regulator family
This family includes UL69 and IE63 that are transcriptional regulator proteins.
Statistics
?
PSSM-Id: 398881
Aligned: 12 rows
Threshold Bit Score: 210.307
Threshold Setting Gi: 327488209
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6HAT_A  53 ISSKQLTANLLPVKFKPLl-SIVRYTPNYYYWVSXRKETIASANLCTVAAFLDESLCWGQQYLKNDFIFSenGKDIILDT 131 Herpesvirus saimiri (...
Q69154 204 THDELINTNYLLLFRKHF--DALPPEELRVLVQDRTFAINNAPSLDVVAAMADENLTYVKFHRVHNLPVN--PKDLYMST 279 Murine cytomegaloviru...
5ZB3_A  69 LINKKISAKKIDHLHRQMl-SFVTSRHNQAYWVSCRRETAAAGGLQTLGAFVEEQMTWAQTVVRHGGWFDekDIDIILDT 147 Human gammaherpesvirus 8
Q66659 427 ciNKTVSLRKLDAKFDPLk-TFTAKTVNFGQWLDVRKDSIINSGMSTQVVFLEELCAWAKLNLQHGCNLE--ERDLILHT 503 Equid herpesvirus typ...
O36407 216 LQDKSISTKYLAENFYDLr-DFAQRSINKSAWINLRREAIANAGFVNLCAFADEMMMWLQLNLNNQGSWKacREDIILTG 294 Alcelaphine herpesvir...
Q1HVH2 258 AWQKVQPRHELRRSYKTLr-EFFTKSTNKDTWLDARMQAIQNAGLCTLVAMLEETIFWLQEITYHGDLPLapAEDILLAC 336 Epstein-barr virus st...
Q6SW73 293 SHDELMHTDYLLHIRQQF--DWLEEPLLRKLVVEKIFAVYNAPNLHTLLAIIDETLSYMKYHHLHGLPVN--PHDPYLET 368 Human herpesvirus 5 s...
P52539 137 LTNDILETDLLLRYRQCL--DSLTREENQQLMGDRIFSLTNSPCLAFTVATVEEACSYFKFHDLHNLPVN--PQDLFMYT 212 Human herpesvirus 6 s...
Q6UDM4 430 vgARMDSWSELCRRAAFLkaRWSSQPSVTRVARAVRSLYLTNCSFDELLEACDETLTWMLWHQFEDERLC--PHDPIFSN 507 Psittacid herpesvirus...
Q77MR3 267 lcGPQITWEYLLHAGPELrnTFEIRPRISLQASAAREAVLRGESFIAALGSAEETLSWLKLHAVLKLRLV--NHDPIFKT 344 Marek's disease herpe...
P28276 305 AETRRVSWETLVAHGPSLyrTFAANPRAASTAKAMRDCVLRQENLIEALASADETLAWCKMCIHHNLPLR--PQDPIIGT 382 Human herpesvirus 2 s...
P09269 240 GIKQNTSWPELMLYGHELyrTFESYKMDSRIARALRERVIRGESLIEALESADELLTWIKMLAAKNLPIY--TNNPIVAT 317 Human herpesvirus 3 s...
6HAT_A 132 SSALLSQLVHKIKxlPFcHCLXQTTPQDHiVKQVCYLIASNNRILDA----------------VRYLQTSVIKSPIVLLL 195 Herpesvirus saimiri (...
Q69154 280 LGLIKYATFNKLNlgEL-SCLLDSPGGGG-SDREYHILRQIANKPASpcrkggssaaaaasfdVLRRPPLSFKHPLQQAL 357 Murine cytomegaloviru...
5ZB3_A 148 AIFVCNAFVTRFRllHL-SCVFDKQSELAlIKQVAYLVAMGNRLVEA----------------CNLLGEVKLNFRGGLLL 210 Human gammaherpesvirus 8
Q66659 504 AETVCSQLMYKLK--PImSCLEPNKPYASmAKQMAYLVCGAGRIQDA----------------GMLLREVKVGSPLTMLV 565 Equid herpesvirus typ...
O36407 295 APDMCFHALQKVR--AFiKCFLRERHQRAlVNALCHIICFEGGIKQA----------------ATLCQELFFDFKVGLMV 356 Alcelaphine herpesvir...
Q1HVH2 337 AMSLSKVILTKLK--ELaPCFLPNTRDYNfVKQLFYITCATARQNKV----------------VETLSSSYVKQPLCLLA 398 Epstein-barr virus st...
Q6SW73 369 VGGMRQLLFNKLNnlDL-GCILDHQDGWG--D-HCSTLKRLVKKPGQmsawlr-----ddvcdLQKRPPETFSQPMHRAM 439 Human herpesvirus 5 s...
P52539 213 ITVMKFEFFNKLNmaKL-TCVFNDNGHG---DIEYRKLRQLCGKPVLdremp------nsefeVQQQTPDSFRHPIQQAM 282 Human herpesvirus 6 s...
Q6UDM4 508 IYALVQGLVTRLG--AVlHCHLAASKSP---------LADPTRTSEL--------------------PLQSATCPLTLFL 556 Psittacid herpesvirus...
Q77MR3 345 AGAVLDNLRLKLA--PImMCKYGTEKRS---------------MGDM----------------LRRSAPEDINDSLTLCL 391 Marek's disease herpe...
P28276 383 AAAVLENLATRLR--PFlQCYLKAR--------------GLCGLDDL----------------CSRRRLSDIKDIASFVL 430 Human herpesvirus 2 s...
P09269 318 SKSLLENLKLKLG--PFvRCLLLNRDND----------LGSRTLPEL----------------LRQQRFSDITCITTYMF 369 Human herpesvirus 3 s...
6HAT_A 196 AYAVCLPAAIIC----TKNETQlYSHCXR-I-----LKEYRPGDVXNILHESLTQHlnKCPSSTCAYTTRAIVGTkaNTT 265 Herpesvirus saimiri (...
Q69154 358 ALIASFARIVGVirrrSLRHSG-PFFIRD-FddtgaTDSYRCGMISELIFDYLPGH--RCQNEICRVKLKKLLQP--YTS 431 Murine cytomegaloviru...
5ZB3_A 211 AFVLTIPGMQSRrs-iSARGQElFRTL---------LEYYRPGDVMGLLNVIVMEHhsLCRNSECAAATRAAMGSakFNK 280 Human gammaherpesvirus 8
Q66659 566 AFSLCVPVMITC----RNRNPSlFNYCKS-F-----LDMYQPGLLCALFNTMTSKLntTCTEEECYASVRAAIGSvvNTR 635 Equid herpesvirus typ...
O36407 357 LYFLTPYAFLYSh---TIPQCNfGGYFSK-C-----VAQYTPGAVTGLLNSAIEDHykDCTSQDCTNLITAIVSPetSNK 427 Alcelaphine herpesvir...
Q1HVH2 399 AYAAVAPAYINAncrrRHDEVEfLGHY---------IKNYNPGTLSSLLTEAVETHtrDCRSASCSRLVRAILSPgtGSL 469 Epstein-barr virus st...
Q6SW73 440 AYVCSFSRVAVSlrrrALQVTGtPQFFDQ-FdtnnaMGTYRCGAVSDLILGALQCH--ECQNEMCELRIQRALAP--YRF 514 Human herpesvirus 5 s...
P52539 283 SIVVTFARILRQikehIIRTKK-PQFIRD-FdtervAERYECGLISRLIGKQFSNH--KCDDVSCQNRIERIMAP--WKP 356 Human herpesvirus 6 s...
Q6UDM4 557 TFADRFARVMHGhphvTLVGHKiVDHEGV-L-----RTLYLPGMCARKIPVVLDQHanVCRKEECRLLCAQLLGKq-YTV 629 Psittacid herpesvirus...
Q77MR3 392 ILLSRIRRVMHR--------TSgSKYSYM-IdprgcMIDYVPGECMTNILRYVDAHtrRCSDPACNLYISCTLMPi-YIH 461 Marek's disease herpe...
P28276 431 VILARLANRVER-------GVSeIDYTTVgVgagetMHFYIPGACMAGLIEILDTHrqECSSRVCELTASHTIAPl-YVH 502 Human herpesvirus 2 s...
P09269 370 VMIARIANIVVR-------GSKfVEYDDI-ScnvqvLQEYTPGSCLAGVLEALITHqrECGRVECTLSTWAGHLSdaRPY 441 Human herpesvirus 3 s...
6HAT_A 266 GLFFLP 271 Herpesvirus saimiri (strain 11)
Q69154 432 TLFFCA 437 Murine cytomegalovirus (strain Smith)
5ZB3_A 281 GLFFYP 286 Human gammaherpesvirus 8
Q66659 636 GLLFVP 641 Equid herpesvirus type 2 strain 86/87
O36407 428 GLLFFP 433 Alcelaphine herpesvirus 1 strain C500
Q1HVH2 470 GLFFVP 475 Epstein-barr virus strain ag876
Q6SW73 515 MIAYCP 520 Human herpesvirus 5 strain Merlin
P52539 357 SLFFCT 362 Human herpesvirus 6 strain Z29
Q6UDM4 630 GKFLCC 635 Psittacid herpesvirus 1 Amazon parrot/1997
Q77MR3 462 GRYFYC 467 Marek's disease herpesvirus type 1 strain MD5
P28276 503 GKYFYC 508 Human herpesvirus 2 strain HG52
P09269 442 GKYFKC 447 Human herpesvirus 3 strain Dumas
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap