Conserved Protein Domain Family
Clavanin

?
pfam05452: Clavanin 
Clavanin
This family consists of clavanin proteins from the haemocytes of the invertebrate Styela clava, a solitary tunicate. The family is made up of four alpha-helical antimicrobial peptides, clavanins A, B, C and D. The tunicate peptides resemble magainins in size, primary sequence and antibacterial activity. Synthetic clavanin A displays comparable antimicrobial activity to magainins and cecropins. The presence of alpha-helical antimicrobial peptides in the haemocytes of a urochordate suggests that such peptides are primeval effectors of innate immunity in the vertebrate lineage.
Statistics
?
PSSM-Id: 147565
View PSSM: pfam05452
Aligned: 2 rows
Threshold Bit Score: 114.992
Threshold Setting Gi: 67460433
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O18493  1 MKTTILILLILGLGINAKSLEERKSEEEKVFHLLGKIIHHVGNFVYGFSHVFGDDQQDNGKFYGHYAEDNGKHWYDTGDQ 80  Styela clava
O97395  1 MKTIILILLILGLGIDAKSLEESKADEEKFLRFIGSVIHGIGHLVHHIGVALGDDQQDNGKFYGYYAEDNGKHWYDTGDQ 80  Styela clava
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap