Conserved Protein Domain Family
MtrB

?
pfam05440: MtrB 
Tetrahydromethanopterin S-methyltransferase subunit B
The N5-methyltetrahydromethanopterin: coenzyme M (EC:2.1.1.86) of Methanosarcina mazei Go1 is a membrane-associated, corrinoid-containing protein that uses a transmethylation reaction to drive an energy-conserving sodium ion pump.
Statistics
?
PSSM-Id: 398873
Aligned: 28 rows
Threshold Bit Score: 109.645
Threshold Setting Gi: 502721734
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O27228          6 LVKIAPEYNLTLDPSTGMIGAAlGREVIILSMDEINEQIAELEATADDLINSLDPTTTPLDSYPGREGVYLTAGKLTNMV 85  Methanothermob...
jgi:Mfer_0780   6 FIHVAPEFNLALDPSAGVISTAlGRDVIVLSMDDLNKELDKLEVAVDNLYNSLDPNTIPPESYPGREGIYITQGKITNMI 85  Methanothermus...
WP_023992797    6 LVKVVPEMNLTLDPTSGMIGAAlGRDVVIVSMDGVNEQLDELEVAVEDLYTALDPTTTSEGSYPGREGTYMMAGTLTNMV 85  Methanobacteri...
WP_016359088    7 LIQVVPEMNVNLDPISGVLGAG-GGDLVILSMDDINAEIDKVCAAADELSNSLDPTTAPEGSYPNREGNYVIAGTLTNMV 85  Methanobreviba...
WP_012956718    5 LIQFIPELNLNLDPETGLLGAG-GGDLIILSMDEINGEIAKVEAAADELMNSLDPNSAPLGSFPGREGNFVIAGTLTNMV 83  Methanobreviba...
O32866          3 IVLIDPESQIAMDAVTGAVAEW-SEDVVTLDVMPLYEKVEELEQYVNDMMRAMDPSTTTWGTLPGREGVHETAGFLTNFA 81  Methanopyrus k...
Q58260          4 YVFIDQNIPLVYTVETGVITKG-FGDLLFVDVSPIEEQIKKLETLVDAYEHSLDPRYPPLNSFPNRDGVYAISGYFKSAF 82  Methanocaldoco...
A6UWH6          3 LVKICPEIGIVMDVDTGIVAEM-RKDILVVDLNPIKEEINKLETLSKAFENSLDPRSAPLKAYDGRDNIYSVGGLFQSAF 81  Methanococcus ...
WP_013180517    3 IVKVCPDINVVLDIDSGLIAEM-RKDILVTDLKPVSAEIEQLEKLAIALENSLDPRNAPMKSYVGREGTYKIGGLFQGMF 81  Methanococcus ...
Q0W335          4 YVKLLPEYKLSYNYKTGKVEPE-AGGVVKYNFKPINENLDKLDKYADDLMNSLTPTGPFLETYPGREKSLYYASIGTNLF 82  uncultured met...
O27228         86 YGFILGLIILFALLL 100 Methanothermobacter thermautotrophicus str. Delta H
jgi:Mfer_0780  86 YGFVFGLIVFALILl 100 Methanothermus fervidus DSM 2088
WP_023992797   86 YGFILGLVLLLALLL 100 Methanobacterium sp. MB1
WP_016359088   86 YGFLIAVFIIIAMip 100 Methanobrevibacter
WP_012956718   84 YGFIIGMFLImaamp 98  Methanobrevibacter ruminantium
O32866         82 HGFVIGTMIVALVAF 96  Methanopyrus kandleri AV19
Q58260         83 FGFWIGLGIMALLAI 97  Methanocaldococcus jannaschii DSM 2661
A6UWH6         82 FGFWISLSILTLgli 96  Methanococcus aeolicus Nankai-3
WP_013180517   82 FGFWIALSILMLAVF 96  Methanococcus voltae
Q0W335         83 YGFIFGGIAAFVLVM 97  uncultured methanogenic archaeon
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap