Conserved Protein Domain Family
TRH

?
pfam05438: TRH 
Thyrotropin-releasing hormone (TRH)
This family consists of several thyrotropin-releasing hormone (TRH) proteins. Thyrotropin-Releasing Hormone (TRH; pyroGlu-His-Pro-NH2), originally isolated as a hypothalamic neuropeptide hormone, most likely acts also as a neuromodulator and/or neurotransmitter in the central nervous system (CNS). This interpretation is supported by the identification of a peptidase localized on the surface of neuronal cells which has been termed TRH-degrading ectoenzyme (TRH-DE) since it selectively inactivates TRH. TRH has been used clinically for the treatment of spinocerebellar degeneration and disturbance of consciousness in humans.
Statistics
?
PSSM-Id: 398871
Aligned: 14 rows
Threshold Bit Score: 145.706
Threshold Setting Gi: 1062945025
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003439044   6 LLILASLTVCNLMVSGGQSMSAEDETDRK------TIDDIi-LERAET-LLLRSILKKLQDEDGRNdG-----YYS--QP 70  Nile tilapia
XP_005053391  64 pLLLLCLTLCGVCFNGGHLLPEESKNMGKs-----PLDDI--LQRSES-FILQSVLKKAEKEEEINkE-----SNAp-LL 129 Collared flycat...
XP_012948030   7 pLLLLCLTLSGVCLNGGQPLPEASENMGRr-----PLDNI--LQRSES-FILQSVLKKAEKKEEMNkE-----LNAp-LP 72  mallard
XP_003210272   7 pVLLLCLTLSGVCLNGRQSPPEVREKMGRs-----SLDDI--LQRSGS-HMLQSAVKKLEKKEEMNkE-----LNVp-LP 72  turkey
XP_001491323   6 SLLAMALTLTLTGVPGGRSQPEAAQQEAAmgaehpGLDDL--LRQAERlLLLREDLQRLREDQGEReS-----ESQifQP 78  horse
ALD51569       6 LLALALLVVCNFTVSGGQSIPAEDETGGR------TIDDIi-LQRAES-LLLRSILKKIQDEDGGDeG-----FPP--QA 70  three-spined st...
Q1T735         6 LLILASLAICNFTVSDAQSISAEDETDRTt-----TTDDIi-LRRAES-LLLRSLLKKMQDEDDINdG-----VYA--QQ 71  Japanese medaka
NP_001106463   6 WLLLLATTLSQMVHTQEQPLLEEDSA---------PADNLdvLEKAKG-ILIRSILEGFQEGQQNKrA-----FPD--EM 68  tropical clawed...
XP_006083864   6 LLLALALTLTLTGVPGGRAQLEVDQQEAAmaaehpALRDL--LRQAGHlLLLREDLQRLQGDQGNReSesqifQS----- 78  little brown bat
XP_005997878  39 LLLLVSLGLSSMTAVLGQHAPEGVESEESv-----PMDDL--LQQAES-ILLRSILKKMEEEKDLHdP-----TAS--QV 103 coelacanth
XP_003439044  71 EWVTKRQHPGKRYSDDLEKRQHPGRREEDEDEqyFDVQKRQHPGKRED---------------------------E--TH 121 Nile tilapia
XP_005053391 130 QWLSKRQHPGKKYLSNLEKRQHPGKRDVEEETsyGDIQKRQHPGKREM---------------------------EddPD 182 Collared flycat...
XP_012948030  73 EWLSKRQHPGKRYISDLEKRQHPGKRDVKEEAsyGDIQKRQHPGKREV---------------------------EddLA 125 mallard
XP_003210272  73 QWLSKRQHPGKRYISDLEKRQHPGRRDVEEAAsfGDIQKRQNLGKTEG---------------------------Y--LA 123 turkey
XP_001491323  79 NWLSKRQHPGKR-EEEAEE----RVEEEEAEEgaVGRHKRQHPGRRED---------------------------EaaWS 126 horse
ALD51569      71 EWMTKRQHPGKRYGEDLEKRQHPGRREADVDEpyLDVQRRQHPGKRED---------------------------E--MR 121 three-spined st...
Q1T735        72 DWMAKRQHPGKRYREDLEKRQHPGRREEDEDEeyLNAQKRQHPGKRED---------------------------E--IQ 122 Japanese medaka
NP_001106463  69 EMISKRQHPGKRFQEELEKRQHPGKRDLGDl--nLELSKRQHPGRRFL---------------------------E---- 115 tropical clawed...
XP_006083864  79 NGLSKRQHPGKR-EEEAEE----GVEDEEEEGgaVGPHKRQHPGPWEN---------------------------AaaWS 126 little brown bat
XP_005997878 104 EWISKRQHPGKRFQAELEKRQHPGKRDEDEEIayIEAQKRQHPGKRGGeeendnlqaqkrqhpgkrddaedddgdEg-LD 182 coelacanth
XP_003439044 122 SFLEPQKRQHPGKRS----TAGHSSDNP---ILLLSELSKRQHPGKRYLv-LHSKRQHPGKRLLEDEDgdrd-wdadADG 192 Nile tilapia
XP_005053391 183 VYLELIRQQPPRRKS----LLDQFANSPraqLTYANKLSTREHPGRRYP---MYKHQRPSKRGWNY-----------EVD 244 Collared flycat...
XP_012948030 126 SYLELKKRQHPGRRS----LWDQHVDIPsarLTYLNVLSKRQHPGRGYL---MHKHQHPSKRGWND-----------ELD 187 mallard
XP_003210272 124 NYLELKKRQHPGRRS----LWDQSTDISnsqLTYLNELSKRQHPGRRYL---MYKHQHPSKRSWND-----------ELD 185 turkey
XP_001491323 127 ADATQQKRQHPGRRSs--------------wLGY--TFTKRQHPGRRLV-------DPQAQRSWEDEE---------EER 174 horse
ALD51569     122 PFTELQKRQNPGKRF----AAGRVSENP---AVL--ELSKRQHPGKRYLv-VQTKRQHPGKR---DGDddvdwdadgEGG 188 three-spined st...
Q1T735       123 SSMGLQKRQHPGKRF----LTGHISDNP---IIMLGELSKRQHPGKRYLv-LQSKRQHPGKRYQDDEDsdg---dweAAE 191 Japanese medaka
NP_001106463 116 ---EIEKRQHPGKREegewSRGYRSDDSs-yLDLLSDVSKRQHPGKRIPdpLFTKRQHPGKREAEEED---------DTE 182 tropical clawed...
XP_006083864 127 VDVTPQKRQHPGRRSf--------------wLGY--TFTKRQHPGRRLV-------DPKAQRSWEEEEe--------EEE 175 little brown bat
XP_005997878 183 EYTEVQKRQHPGRRS----TLDQFTDSPntqLAFLSELSKRQHPGKRYL--LYNKRQHPGKRGWDK-----------ELD 245 coelacanth
XP_003439044 193 EEDLAEMEKRQHPGKRFWDNSSADLgtNSPCDVLDPASCSKTS 235 Nile tilapia
XP_005053391 245 LYS----EKLQHPGKRHWNSGSSGD--TGPCNFQESFTCHKGs 281 Collared flycatcher
XP_012948030 188 ISD-HDGEKRQHPGKRHWDTDNPDY--AGPCDLQESSTCNTGs 227 mallard
XP_003210272 186 LGD-QNWEKHQNFGKRNRDSDSPDY--AGPCDLQQSAICNKgs 225 turkey
XP_001491323 175 EEGELMPEKRQHPGKRAL---------GSPCGPRGA--CGQAS 206 horse
ALD51569     189 EEDLVEMEKRQHPGKRFWDTSSPDLgtNSPCDVLDPTSCRKTS 231 three-spined stickleback
Q1T735       192 EVDLPELEKRQHPGKRFWDNSNPEL--GNPCDALEPDNCSKTN 232 Japanese medaka
NP_001106463 183 FEISKEVAKRQHPGKRF-----------DPCEGPNAYNCNSGN 214 tropical clawed frog
XP_006083864 176 EEGELMPEKRQHPGKRAL---------GGPCGLQGD--CGQAS 207 little brown bat
XP_005997878 246 YEDLQELEKRQHPGKRQLPPESPDY--GLPCDILDPINCSKTS 286 coelacanth
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap