Conserved Protein Domain Family
BSP_II

?
pfam05432: BSP_II 
Bone sialoprotein II (BSP-II)
Bone sialoprotein (BSP) is a major structural protein of the bone matrix that is specifically expressed by fully-differentiated osteoblasts. The expression of bone sialoprotein (BSP) is normally restricted to mineralized connective tissues of bones and teeth where it has been associated with mineral crystal formation. However, it has been found that ectopic expression of BSP occurs in various lesions, including oral and extraoral carcinomas, in which it has been associated with the formation of microcrystalline deposits and the metastasis of cancer cells to bone.
Statistics
?
PSSM-Id: 398866
Aligned: 16 rows
Threshold Bit Score: 150.023
Threshold Setting Gi: 524994200
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002815004  17 FSMKNLHRRVKIEDSEENGVFKYRPRYYLYKHAYFYPHLKRFPVQGSSDSSEENGD-DSSEEEEEEEETSNEGENNEE-- 93  Sumatran orangutan
3_pfamImport   1 FSMKNLHRRVKPEDSEENGVFKYRPRYYLYKHAYFYPALKRFPVQSSSDSSEENEDgDSSEEEEEEEETSNEEEKDENs- 79 
P31936         1 FSMKNFHRRAKLEDPEENGVFKYRPRYYLYKHAYFYPPLKRFPVQSSSDSSEENGNgDSSEEEEEEEENSNEEENNEEne 80  pig
XP_001364440  17 FSAKHLYRRAKLEDSEENGVFNHRHRYYLNKYSYFYPPLKRIPVQHNGDSSEE-GDgDSSEEEEEEEET-----SNEEes 90  gray short-tail...
XP_003221343  17 FSVKSFRRRFKADDSEENAVFKNRFWPFFYRQPYLYPPMKR--QQFNSDSSEEGYGgNSSEEEEEEEAG----PSNEEn- 89  green anole
XP_004870614  17 LSMKNLHRRFKLEDSEENGVFKYRPRYYLYKHGYFYPPLKQFAVQGNSDSSEENGNgDSSEEEEEEDETSNEEENNEDs- 95  naked mole-rat
XP_003515346  17 FSMKNLHRRVKAEDSEENGVFKYRPRYFLYKHAYFYPPLKRFPVQGGSDSSEENGDgDSSDEEGE-EETSNEEENNEDs- 94  Chinese hamster
XP_008265839  17 fsMKNLHRRVKLQDSEENGVFKFRPQYYLYKHAYFYPPLKRFPVP-SSDSSEENGEgDSSDEEEEGEETSNEEENNEDs- 94  rabbit
XP_003773007  17 FSVKNLYRRAKLGDSEENGVLNHRHRYYIYKYSYLYPPLKRIPVQRNGDSSEE-GDgESSEEEEEEE----ENSNEEEet 91  Tasmanian devil
XP_028932449  17 FSVKNLHRRAKVEESEENAVFKHRPRYYIYKYAYLYPPQKRILSQSNSDSSEEGGDgDSSDEEEEEETSNEENEENEE-- 94  platypus
XP_002815004  94 ---SNEDEDSEA-ENTTLSATTlGYGEDATLATGYPG-LAAIQLPK------------------K---AGDITSKATKEE 147 Sumatran orangutan
3_pfamImport  80 --nGGRYLTREF-KALEKSATM-GEGVLQVQGHGRMGsELSFCFSF------------------Q---AGDMRKQATKKE 134
P31936        81 dsdGNEDEDSEA-ENITLSTTTlGYGGDVTPGTASIG-LAALQLPK------------------K---AGDIGKKSAKEE 137 pig
XP_001364440  91 etnGSEDEEEEGgESTTLSATTsGYEEENTTASGDVG-LAAIQIPK------------------K---GEDSKNN-TKKE 147 gray short-tail...
XP_003221343  90 ---EGEQEKEEA----TKAPSEpATGDKK-------G-VSDSKPPKqvpvkkeplgkpgkeggaKkaeKDKAPEKGGKEE 154 green anole
XP_004870614  96 --nGNEDEDSEA-ENTTLSTITpGYGEETTPGTDYIG-LAAIQLPK------------------K---AGDIGNKATKKE 150 naked mole-rat
XP_003515346  95 --eGNEDEEAEA-GNTTLSSVTaSYGAETTTEAGSIG-LAALQLPK------------------K---AGDAESKAAKNK 149 Chinese hamster
XP_008265839  95 --nGNEDEESEA-ENSTLSFTTpDYGE-ITRGTGYIG-LAGIKLPK------------------K---AGAIENKATEEE 148 rabbit
XP_003773007  92 esnGSE-------ESTTLSATTlGYGEENTTASGDIG-LAAIQNPK------------------K----EEKNNQVTKKE 141 Tasmanian devil
XP_028932449  95 -----EDENSEGeESTTVSATTpLYGEETTPGRGDNG-LGAIKVPK------------------K--------------- 135 platypus
XP_002815004 148 ESDEEEEEEEe---ENENEESEAEVDENE---------------QGINGTSTNSTEAENGNGSSGGDN-GE--EGEEESV 206 Sumatran orangutan
3_pfamImport 135 ESDEEEEEEEe--eENENEENEAEVDEND---------------QGVNGTSTNSTETENGNGSSGGDA-GE--GGEGDSV 194
P31936       138 ESDEDEEEEE------ENEENEAEVDDNE---------------QGTNGTSTNSTEVDSGNGHSGGDN-GE--EGDQESV 193 pig
XP_001364440 148 ESDEEEEEEEe---EEENKESEAEVDKNK---------------EVVNGTDH----GD-GNGTSG----KE--DGEEEEE 198 gray short-tail...
XP_003221343 155 EEDSDENEEEen-eEEENEEQE-KVDENG---------------NGVNGTSTNSTAEENGNGGKG-----E--EEEEEEE 210 green anole
XP_004870614 151 ESDEEEEEEE-----NENENNEAEVDGNE---------------QAVNGTSTNSTEVENGNGSSGADN-GE--EGDKESV 207 naked mole-rat
XP_003515346 150 ESDEEEEEEE------ENENEEAEVEENE---------------QVANGTSANSTEAYGGNSSSGGDN--G--EGEEQSV 204 Chinese hamster
XP_008265839 149 ESDEEEEEEE----ENENEENEAEVDENE---------------QSINGTSSNSTEAEN----------GE--AGEGESV 197 rabbit
XP_003773007 142 ESDEEEEEEE------ENEESEAEVDENK---------------EGGNSTNHENAEGDHGNGNGG----KE--EGEEEEE 194 Tasmanian devil
XP_028932449 136 --------AEtrksTKKEESDEEEEEEEEeneneeseaeveeneQGINGTSTNSTE---DSGNDGGENgGEaaEEEEESV 204 platypus
XP_002815004 207 TganaegttatgGQGKGSSKTTTSPNGGFE---PTTPPQ-VYRTTS-PPFGKTTTVEYegEY----------EYTGANEY 271 Sumatran orangutan
3_pfamImport 195 T-----------GETAGTRGQTTSPNGGFQ---PTTPPPeVYGTPS-PPSGKTTTFEYeeEY----------EQTGTNEY 249
P31936       194 Teaqgt--tvagEQDNGGAKTTTSPNGGLE---PTPPPQdISGTTL-PPSGKTTTPEYegEY----------EQTGAHEY 257 pig
XP_001364440 199 Vengt---essvDKDNNSTELATSPNSRYE---STTPLEgTYEVTS-PPYEESTSNLYdsGY----------EEPVTNEY 261 gray short-tail...
XP_003221343 211 Ne-----------------aTTIVPTTLFTtvvPTTEYQdQYDTTTeEQWHAETTPEDqwQYdtttedpwvhDTTTTTGY 273 green anole
XP_004870614 208 TeantpgttmsaGQSTGSSKTTPSPNGVFE---PTTPAPeVYGSTP-PPYGKTTTAEYgaEY----------EQTGANEY 273 naked mole-rat
XP_003515346 205 TeagvegttldrEQISDGPTTAVLPNG-FQ---YTTPPPeAYGTTA-PPFRKPTTAEYwgEY----------EQTGNNED 269 Chinese hamster
XP_008265839 198 TatdaagtatrgEWISRAAETTTAPSGGFE---PTTPPPeAYGTTS-PPFGKTTAAEYggEY----------EQTGNHGY 263 rabbit
XP_003773007 195 Vengt---eateNEASNSTEVTTSLNG-YE---FTTLLKgDFEVTS-PPYEESTSNLYdsGY----------EEPVTNEY 256 Tasmanian devil
XP_028932449 205 Tea--------nQEENGGQETTTFVDSVQG---ATTPSNgAYEVTT-PP---TTSN----GY----------EETVTNEY 255 platypus
XP_002815004 272 DNGYEI---YE-SENGEPRGDNYRAYEDEYSYFKGQGYDGYDGQnYY 314 Sumatran orangutan
3_pfamImport 250 DNGYEV---YD-SENGEPRGDTYRAYEDEYSYYKGQSYDGYEGY-YY 291
P31936       258 DNGYEI---YE-SENGEPRGDSYRAYEDEYSYYKGRSYNSYGGHdYY 300 pig
XP_001364440 262 DNGYEI---YE-NENGEPRGDNYRAYEDEYSYYKGHPYNGYEGQdYY 304 gray short-tailed opossum
XP_003221343 274 ENGYETqtdYYgSENGYPRGDTFRAYEDEYSYYKGHGYDVY-GQdYY 319 green anole
XP_004870614 274 DPGYEV---YD-NENGGPRGDNYRAYEDEYSYYKGRGYDGYDGQdYY 316 naked mole-rat
XP_003515346 270 NGEYQI---YD-NENGEPRGDTYRAYEDEYSYYKGRGYEGYDGQdYY 312 Chinese hamster
XP_008265839 264 DDGYEI---YE-NENGDPRGDNYRAYEDEYSYYKGRGYEGYEGQdYY 306 rabbit
XP_003773007 257 DNGYEV---YE-NENREPRGDNYRAYEDEYSYYKGHAYNGYGGQdYY 299 Tasmanian devil
XP_028932449 256 DSGYEV---YE-NENAEPRGDNFRTYEDEYSNYKGRGYDGYDGRdYY 298 platypus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap