Conserved Protein Domain Family
FIBP

?
pfam05427: FIBP 
Acidic fibroblast growth factor binding (FIBP)
Acidic fibroblast growth factor (aFGF) intracellular binding protein (FIBP) is a protein found mainly in the nucleus that is thought to be involved in the intracellular function of aFGF.
Statistics
?
PSSM-Id: 398862
Aligned: 20 rows
Threshold Bit Score: 476.405
Threshold Setting Gi: 326432228
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EEN41942       4 VNVFVTNNTYIDFDVFGHWLNGLTVHEAVQARLQSGilQSTGASPDMLQSDTLDNYRTFSLLERFLQSPPKLATQVLLQI 83  Florida lancelet
EEB16458       7 VDVFISNYTLVDPEVYQLWVEGHSSTEAVNTLESREivQQTGASLDLVESDVLDHYRTYNLLEKLLHNPIKLAEQLSFQL 86  human body louse
EDX11129       4 VDVFISNYTIIDPEIYQLWIEGFSSSEAVSYLKQKGfgHSMGAPSDLIASDVLDHYRTYSLIELYLNAPTKLMEQSCFQL 83  Drosophila simu...
Q16PP4         5 VDVFISNYTLVDPEIYQLWIEGYSSTEAVTLLKQKGn-lMAGIPLDLITSDVLDHYRTYSLLERLLHTPSKLSEQPTFQL 83  yellow fever mo...
Q7QKD1         3 VDVFISNYTIIDPEIYQLWVEGYTFVEAVTLLKQKGg-lFADVPPELIASDVQDHYRTYAMLEKFLHAPPKLSEQPTFQI 81  Anopheles gambi...
EFA08394       5 IDVFISNYTLVDPEIYQLWVEGHTASEAVSILNQRGlgQVTGASLELIASDVLDHYRTYSLLEKLLSNPNKLQEQLAFQI 84  red flour beetle
XP_001946018   8 VDVFISNYTIVDPDVYHLWVNGYSASEAVSILKQYGilEEMGTTLDLVASDILDHYRTYSLLEKIIHYPTKLDQQLAFQI 87  pea aphid
1_pfamImport   2 VDVFISNYTIVDPEVYQLWVDGCTAEVAVDIVHKHAf--KSEHTLDLVKSDVSDHYRTYSLLEKLLHNPPKLAEQLHFQI 79 
XP_015792765   8 VDVFIGSNTIIDEHIYTCWLDGYTPQETAILVKEKEciVLRGIHDDLIISDVLDQYRLFGLIERLLQSPSMIGQGWSLQI 87  two-spotted spi...
EEC03150       5 VDVFVGNNTLIDPDVFQLWLEGYSAQDAAVTLHHNEvmKESDIPLELLKSDVLDHYRTLQMLERLLHSPVHLAEQWTFQL 84  black-legged tick
EEN41942      84 PAAVQRTLIEKYYDFDSTVIREILGKKLTNRHRKDVDDVSERTNIRLRSCR--RQYDNCKNIFKTVEDMEGSLVNNISGH 161 Florida lancelet
EEB16458      87 EPQTQQLLIEKYYEFDDSVIRELLGKKLSSRHRKDLDEVSDKTNVLLKSCR--RQFDNVKRVFKTVEELTGNMVQNIKSN 164 human body louse
EDX11129      84 EPHMRDLITEKYYSIDDVVAREILGKKLSSRYRKDLDEVAEKTCVKLKSVR--RQFDNVKRIFKAVEEMPGTLTNNIKQH 161 Drosophila simu...
Q16PP4        84 EPQSRSLLIEKYYSLDDSVARELFGKKLNARNRKDLDEVAEKTGVRLKSCR--RQFDNVKRIFKAVEEMPGNTAINIKQQ 161 yellow fever mo...
Q7QKD1        82 CPQDRSLLIEHYYSLDDAVARELFGKKLNARNRKDLDEVADKTGVRLKSCR--RQFDNVKRIYKAVEETQGNLACNIRQQ 159 Anopheles gambi...
EFA08394      85 EPQTRQLLIEKYYDFDDVVVRELIGKKLSSKHRKDLDEVAEKTRVPLKSCR--RQFDNVKRIYKMVEDMPGPVVQNIQNH 162 red flour beetle
XP_001946018  88 EPQTKHILVEKYYEIDDIVVREFLGKKLSSKHRKDLDEVSEKTSIAIKSCR--RQFDNVKRVFKAVEELQGSVIQNISSI 165 pea aphid
1_pfamImport  80 EPLTRQLLIEKYYEFDDSVIRELLGKKLSSRYRKDLDEVSEKTGVSLKSCR--RQFDNVKRIYKMVEDMQGSVIQNIRNL 157
XP_015792765  88 NAKTRRLLIEKYYEFDDCVVREILGKKLSSRNRTELKDVSEKTSVGLKSCR--RQFDNVKRVYKAVEDMGGNLIFNIQNN 165 two-spotted spi...
EEC03150      85 TPQTQRMLIAKY---DGFFTPLILCYKCSISVRKYTIEI---------NCRlnSPFDNIKRVYKVIEEMPGPLTKNIQTH 152 black-legged tick
EEN41942     162 FLLPEKLAKRYAAIVFFSNNRFETGKKKLQYLSFDDFAYCADLMIHNWTFgaagngpslydSQAD-DMDVEMDRVFLQEL 240 Florida lancelet
EEB16458     165 FLLSDELSRKYGAIVFIACVRFETSKRKLQYLTFSDFYHCAMAIMNKWTYr-------------DaFPEFDLDREFLLDL 231 human body louse
EDX11129     162 FFISTDLAKKYACIVFLACLRFETTKKKLQYLSFSDLLTCSHAIMIYWTYty-------qhTGPEyY-DTEMDKEFLLDL 233 Drosophila simu...
Q16PP4       162 FILSDELAQKYAAVVFIACLRFETTKRKLQYLNFKDFYECSQAIMTNWTYty-------qhAGPEyY-DTEMDKEFLLDL 233 yellow fever mo...
Q7QKD1       160 FILPEELAQKYAAVVFIACLRFETTKRKLQYLNFKDFYECGQALMTFWTYty-------qhSGADyL-DTEMDKEFLLDL 231 Anopheles gambi...
EFA08394     163 FYLSEPLAKKYACIVFLACIRFET-KRKLNHITFTCWKRCTEAIMDNWTNk---------lAGVDnF-DTELDKDFFTEL 231 red flour beetle
XP_001946018 166 FLLSEDLAKKYGVIVFIACMRFETSKRKLQMLTFPDFYEPTLCIMNKWTYp---------kSSPEfG-DTDLDREFLLEL 235 pea aphid
1_pfamImport 158 FLLPEDLAKRYGTVVLLACLRLETGKKKLHYLTFRDLYECSMAIMASWTYp---------vGTTDhD-CIDLDREFLLDL 227
XP_015792765 166 FLLSERLAKRYATVVYIANNRFETSKRKINYLKFADFYHCAYQMMTNWSCkn-------peCKYE-ESPMDIDREFLQDL 237 two-spotted spi...
EEC03150     153 FLLPEQLARKYAAVVYITHNRFETGKKKLNYLTLDNFIFCVDQMINNWSCrnpsnlrlhttSLAYeESGMEMDREFLQQL 232 black-legged tick
EEN41942     241 RDLKVLTgEKDVYEKHKGLVCSALRGKIPDPTyad------ieSNFKNLSRCIVSVASGLIHSKELKDFFVDLVEKFIEP 314 Florida lancelet
EEB16458     232 RDVRILS-EKE--REHKHLVCNRLKPTLLERSyve------leNNFRSYSRAIVGLACNLHRSRELRSLFVELVERCIEP 302 human body louse
EDX11129     234 RELRCLL-DKE--KEIKHLVCMRLKPVLLERAfhe------ldGNFRSYWRALITIACNLHRNRELRDLFVDLCEKLIDP 304 Drosophila simu...
Q16PP4       234 REIRYLL-DKE--KEIKCLVTIRLKPTMLDRTyqe------mdTSFRSYWRSIITIATSLHRTREMRQLFLELTERLIEP 304 yellow fever mo...
Q7QKD1       232 REIRYLL-DKE--KEIKHLVSLRLKPTLLERAyqe------veNNFRSYYRAIIMIACNLHRTRELRLLFVELTERLIEP 302 Anopheles gambi...
EFA08394     232 KDIKIMF-EKE--REHKQLVCVSLKATLLHKSytd------ldANFKNYNRALLQPASNMHRPRDVKNMFLEL-NSLSDS 301 red flour beetle
XP_001946018 236 REVRVLL-DKE--KDHKHIVCQKLKPEFLEKTyns------meVNFRLLSRAIIGIAYNLHHNRDLRGFFLEVVERIIDP 306 pea aphid
1_pfamImport 228 RDIRTLL-EKE--KEHKHLVCSKLKPELLDKAyqe------leLNFKNYSRSIITIGCNLHRTRELRMLFVELVEKCIEP 298
XP_015792765 238 RELKVLL-EREYMDEHKINFMRELKSKSVDRMdrldkqindldSLFKNTSRSIINIAFRLNQGKEVRDLFLDIVDKIIEP 316 two-spotted spi...
EEC03150     233 REMKALL-DREHLDRLKDAVTFSLWGRVSKHTlqd------leSNFKSLTRTLVNIAYGLNHSKDLRDFFIDIVEKIIEP 305 black-legged tick
EEN41942     315 CRNARWSKRDVEAFLKAYEAAIQQIPQLKRCPHLLTVWTRYMTTLKK 361 Florida lancelet
EEB16458     303 WRQVSWSHSDLKNFLLAYEQCAIEMDVLRE-GDLKAAWERYMTTISY 348 human body louse
EDX11129     305 WRQNGWNREQVNKFLASITQSVLDLEISRD-QETRCLWDRYMQVITI 350 Drosophila simulans
Q16PP4       305 WKMNNWPKDQVAQFMQCLTQSVLDLEVPRDNQDIRCLWDRYMQVVTI 351 yellow fever mosquito
Q7QKD1       303 WKQNGWTREQVQMFMQCMTQCVLDLEVPRDNQDIRCLWDRYMQVINV 349 Anopheles gambiae str. PEST
EFA08394     302 LKQANWSGQELEIFLNGYTQCGLEIDVIRDSAPMKILWEKYMKVISE 348 red flour beetle
XP_001946018 307 WRILGWIKVDVMNFLKVYVNCAIELDVFQD-AEVKKAWERYMDVITT 352 pea aphid
1_pfamImport 299 WKQVSWSISDLTAFLDAYTHCALQLDCLRE-NDTKTVWERFMNVLTI 344
XP_015792765 317 FKAYKLVKSDLEVFLQLYMESPKNMEVFVRNPDLWVVWLRYMRTLNS 363 two-spotted spider mite
EEC03150     306 CRSAHWTREELQVVMEAFSKSPQSA-TFPHELHLYEVWVRYSETFAK 351 black-legged tick
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap