1Z3X,4YKB,4XKC


Conserved Protein Domain Family
GUN4

?
pfam05419: GUN4 
Click on image for an interactive view with Cn3D
GUN4-like
In Arabidopsis, GUN4 is required for the functioning of the plastid mediated repression of nuclear transcription that is involved in controlling the levels of magnesium- protoporphyrin IX. GUN4 binds the product and substrate of Mg-chelatase, an enzyme that produces Mg-Proto, and activates Mg-chelatase. GUN4 is thought to participates in plastid-to-nucleus signaling by regulating magnesium-protoporphyrin IX synthesis or trafficking.
Statistics
?
PSSM-Id: 398855
Aligned: 73 rows
Threshold Bit Score: 145.39
Threshold Setting Gi: 81671140
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1Z3X_A             97 RGVDYQELAKLLVAEKFEAADRLTTQKLCELAGPLaqKRRWLYFTEVEQLPIPDLQTIDQLWLAFSLGRFGYSVQRQLWL 176  Thermosyn...
jgi:Cyan7822_4897 772 EEDDYSTLIKFLASQQWQEADKETSKKIRKILERQ--DKERVRKRDIRRLSLNELQRIDQLWIHYSNGKFGFSVQQDLWT 849  Gloeothec...
jgi:PCC7424_5109  253 iDSDYSQLIILLASHQWEKADQETAKKMIEIMERQ--DKDDLRTRDIKRFSVNQLQIIDQLWIYFSQGKFGFSVQKDIWT 330  Gloeothec...
jgi:Ple7327_4239   84 DVHRYGKLQQDLASGNWFEADKETVNVILDVAGKP---IEELTPEDIRNFPCNAIATIDLLWLRYSQKRFGFSIQLGIYQ 160  Pleurocap...
jgi:Cyan7822_4758  45 DIYRYEKLQKALLEGDWFEADLETIKIILDLTGKD---KDNLKPEDIQYFPVASLKVIDKLWLKYSQGKFGFTVQLKIYQ 121  Gloeothec...
WP_015122034       76 DIVRYQPLRDMLAAKKWEEADTETIRLIADIAGHK--DLEDFRPAEVQHFPCVQLQVIDNLWLTYSEQRFGFSIQARIYQ 153  Rivularia...
jgi:Chro_3296      46 dIHKYKKLRDLLAAGNLQEADWETIRVILAITGQR--ELESITPEDVKQFPCNELHVIDSLWTTYSKGRFGFSVQMQIYQ 123  Chroococc...
WP_014274903       61 DKYRYGRLQNLLAEGNWREADLETTKVMLEIATQA--HHDDLKPDDVMIFPCSALHLIDSLWVKYSNNRFGFSVQRQIYT 138  Arthrospi...
WP_015219478       34 diARYGTLQKFLKNKDFREADIETTRIMLEVAGEQ---RETLSPEDVSKYPCNSLQVIDQMWYKYSSGKFSFGVQLKNYY 110  Cyanobact...
P74094             47 diERYGRLQECLIAGDFKTADHETTRIILETLNRN---RDNLSPETLSALPCTVLTVIDRLWRTYSEDRFGFSRQLEAYQ 123  Synechocy...
1Z3X_A            177 GCGQ-----------NWDRLWEKIGWRQGKRW---PRYPNeFIWDLSAPRGHLPLTNQLRGVQVLNALLNHP 234  Thermosynechococc...
jgi:Cyan7822_4897 850 KLGGkige---fkneIYDHWATKTGWQVNGSW---KLYDE-LDFSINAPIGHLPAVTVAWSSWGTAwcgket 914  Gloeothece verruc...
jgi:PCC7424_5109  331 ELGGetgk---frnsIYDNWAKKVGWRVNDSW---KKYDE-LDFSLNAPTGHLPAVTLAWSSWGAawcgdet 395  Gloeothece citrif...
jgi:Ple7327_4239  161 TLGGnlettleqdrkLIEKLGERVGWRENNRW---RKCDK-LDYSPNAPVGCHPS------RWWNSPYGskm 222  Pleurocapsa sp. P...
jgi:Cyan7822_4758 122 QLGGnldttiakdqkLIEKWGEQLGWRDNHQW---RKCDE-LDYSFNAPTGCHPS------QWWNSPYGskm 183  Gloeothece verruc...
WP_015122034      154 EVGGsiettieqdskIIEEWGKRLGWRENNRW---KKCDE-LDWSLNAPEGSHPA------RWWNSPFGskm 215  Rivularia sp. PCC...
jgi:Chro_3296     124 NVGGslnttiaqdntVIERFGDRIGWRVDGKW---QKCDR-LDYTLAAPIGCHPS------RWWNSPFGskm 185  Chroococcidiopsis...
WP_014274903      139 ELGGgddis-nidldLLTQVSDRLGWREDHKW---LDYQD-LNFTISAPPGCHPS------NWWRSAYGAKM 199  Arthrospira plate...
WP_015219478      111 EAGGdidtiraqdvkVLTKFADKVGWLNENKQprfSEYDD-WDFSLSAPDGCFPA------HWWKSPYGLKm 175  Cyanobacterium ap...
P74094            124 KVGGntdtlrtqdrkVMGAFAQEVGWVQEGKVr-fDEYDQ-WDFSLNAPVGSFPA------IWWKSPYGLKm 187  Synechocystis sp....
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap