Conserved Protein Domain Family
Peptidase_C34

?
pfam05413: Peptidase_C34 
Putative closterovirus papain-like endopeptidase
Corresponds to Merops family C34. Putative closterovirus papain-like endopeptidase from the apple chlorotic leaf spot closterovirus.
Statistics
?
PSSM-Id: 147545
View PSSM: pfam05413
Aligned: 5 rows
Threshold Bit Score: 184.992
Threshold Setting Gi: 81930225
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAF64462  841 KLRFIKGKFDCLFVSIAEIIHKKPEEVMMFIPHVMDRCVSNRGCSLDDAKAICEKYEIKVECEGDCGLIECGTSGLSVGR 920  Apple chlorotic l...
BAF64465  836 KVKFVKGRLDCLFSSIAEVIHKKPEEVMAFVPHILDRCISNKGCSIDDARAICEAYEIKIECEGDCGLVECGSVGLSVGR 915  Apple chlorotic l...
Q5IJA3    848 KVGFIKGKYDCMISSLASLIRKDQDEMCAFVPNVLNRCISNKGCSIDDLKEMCMAYEFKVPVEGDCGSIEVGSHGMPLGR 927  Apricot pseudo-ch...
Q1PSK2    845 KRKFVNGKFDCLFDAVSKLISKKSEEVMIRNPHILDRCIMNRGCDLDDLRSICNNYEIKVECQGDCGLLEVGSIGMPLGR 924  Peach mosaic virus
Q9IMS9    844 KRKFIEGKYDCLFVAMAAMISKKPEDIMFKCLNTLDRCVMNKGCDLTDLRSICSGYEIKVECQGDCGLVEIGDIGLPLGK 923  Cherry mottle lea...
BAF64462  921 MLLRGNHFTVAS 932  Apple chlorotic leaf spot virus
BAF64465  916 LLLRGNHFRVAS 927  Apple chlorotic leaf spot virus
Q5IJA3    928 LNLRGNHFSVVS 939  Apricot pseudo-chlorotic leaf spot virus
Q1PSK2    925 FMLRGNHFSLCS 936  Peach mosaic virus
Q9IMS9    924 LILRGNHFTLCS 935  Cherry mottle leaf virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap