Conserved Protein Domain Family
Peptidase_C33

?
pfam05412: Peptidase_C33 
Equine arterivirus Nsp2-type cysteine proteinase
Corresponds to Merops family C33. These peptidases are involved in viral polyprotein processing in replication.
Statistics
?
PSSM-Id: 114153
View PSSM: pfam05412
Aligned: 4 rows
Threshold Bit Score: 200.141
Threshold Setting Gi: 62510944
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9DLN8  428 HYSPPAEGNCGWHCISAIANRMVNSKFETTLPERVRPPDDWATDEDLVNAIQILRLPAALdrnGACTSAKYVLKLEGEHW 507  Porcine reproductiv...
Q06502  381 GYSPPGDGACGLHCISAMLNDIFGDSFTTRLGKCSRDSSEWLSDQDLYQLVMTANLPATI---GHCPSAIYKLDCVNQHW 457  Lactate dehydrogena...
Q83017  381 GYSPPGDGACGLHCISAIINDIFGDALCTKLTNCSRDSSEWLSDQDMYQLVMTARLPATL---GHCPSATYKLDCVNQHW 457  Lactate dehydrogena...
Q04561  420 TYSPPTDGSCGWHVLAAIMNRMINGDFTSPLTQYNRPEDDWASDYDLVQAIQCLRLPATVvrnRACPNAKYLIKLNGVHW 499  Lelystad virus
Q9DLN8  508 TVTVTPG-MSPSLLPLECVQGCC-GHKGGL 535  Porcine reproductive and respiratory syndrome virus
Q06502  458 TVTKRKGdRAVGRLAPDCLRGVCgECEMGI 487  Lactate dehydrogenase elevating virus C
Q83017  458 TVTKRKGdRALGGLSPECVRGVC-GGECKF 486  Lactate dehydrogenase elevating virus Plagemann
Q04561  500 EVEVRSG-MAPRSLSRECVVGVC-S-EGCV 526  Lelystad virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap