Conserved Protein Domain Family
DARPP-32

?
pfam05395: DARPP-32 
Protein phosphatase inhibitor 1/DARPP-32
This family consists of several mammalian protein phosphatase inhibitor 1 (IPP-1) and dopamine- and cAMP-regulated neuronal phosphoprotein (DARPP-32) proteins. Protein phosphatase inhibitor-1 is involved in signal transduction and is an endogenous inhibitor of protein phosphatase-1. It has been demonstrated that DARPP-32, if phosphorylated, can inhibit protein-phosphatase-1. DARPP-32 has a key role in many neurotransmitter pathways throughout the brain and has been shown to be involved in controlling receptors, ion channels and other physiological factors including the brain's response to drugs of abuse, such as cocaine, opiates and nicotine. DARPP-32 is reciprocally regulated by the two neurotransmitters that are most often implicated in schizophrenia - dopamine and glutamate. Dopamine activates DARPP-32 through the D1 receptor pathway and disables DARPP-32 through the D2 receptor. Glutamate, acting through the N-methyl-d-aspartate receptor, renders DARPP-32 inactive. A mutant form of DARPP-32 has been linked with gastric cancers.
Statistics
?
PSSM-Id: 398845
Aligned: 9 rows
Threshold Bit Score: 159.207
Threshold Setting Gi: 380817094
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAI70624       2 EANSPRKIQFTVPLL-EPHLDPEAAEQIRRRRPTPATLVLSSDQSSPEiDEERVPNPLQKSSLSMSPHQRKKMSRTTPTM 80  tropical clawed...
XP_001370926   2 DPKDRKKIQFSVPAP-PSQLDPRQVEMIRRRRPTPAMLFRVSEHSSPE-EEASPYQRSSGEGHHLKTKRPNPCAYTPPSL 79  gray short-tail...
AFE80421       2 DPKDRKKIQFSVPAP-PSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPE-EEASPHQRASGEGHHLKSKRPNPCAYTPPSL 79  Rhesus monkey
XP_015217647  11 EPKERRKIQFSVPAPmPSQLDPRQVEMIRRRRPTPATLFRVSDNPSPE-EEHISHQWVVGENGILKPKRSNPCVYHPPSL 89  spotted gar
1_pfamImport   1 EPKERRKIQFSVPAPmPSQLDPRQVEMIRRRRPTPATLFRVSDNPSPE-EEHISHQWVVGENGILKPKRSNPCVYHPPSL 79 
NP_001268852  12 EPKERRKIQFAVPATePTQLDPRQVEMIRRRRPTPATLFKVADQTSPE-DDITSHQWVVGENGILKPKRINPNIYQPPSL 90  zebrafish
XP_019213254  12 EPKERKKIQFAVPANaPTNLDPRQVEMIRRRRPTPATLFRVADQSSPE-DDQSTHQWVVGENGVLKPKRVNPNVYQPPSL 90  Nile tilapia
NP_001002538   2 EPNSPKKIQFAVPLF-QSQLDPQAAEHIRKRRPTPATLVIYNEPSASGdDKQSTGHQTEAQNAQLSPAQRKQSVYTPPTM 80  zebrafish
NP_001096342   2 EPKGRKKIQFSVSAP-AAQLDPRAVEMIRRRRPTPATLFRVSEPQSPD-EDPTAQQK-PGDAQQLKNMRANPCTYIPPSL 78  tropical clawed...
AAI70624      81 KELQLLAEHHLCKQGseeekiphlqnNLDDRPDlgccchgntastqeshipcscftqdGQQENNSLGRrha-----sqED 155 tropical clawed...
XP_001370926  80 KAVQRIAESHLQSIS-----------NLSENQP-------------------------SDEEEEEEGE----------QG 113 gray short-tail...
AFE80421      80 KAVQRIAESHLQSIS-----------NLNENQ--------------------------ASEEEDELGEl--------rEL 114 Rhesus monkey
XP_015217647  90 RAVQRMAQAHMQALGas--------pPLEDPPE-------------------------GVESEDGPPEae------mcED 130 spotted gar
1_pfamImport  80 RAVQRMAQAHMQALGas--------pPLEDPPE-------------------------GVESEDGPPEae------mcED 120
NP_001268852  91 KAVQQMAEAQMQKLGvy--------pHVEEEGEepvhrgg-----------aelcsscTTESQEQRSTpekqsgmrktEA 151 zebrafish
XP_019213254  91 KAVQKMAEAHMQKLGvy--------pPLEDPCE-------------------------GEEDEDYLKGee-------gED 130 Nile tilapia
NP_001002538  81 RELQLVVEQHFQRQEqq-------eaGLSDSPDtpspitt------------qhfatgAQWANHNSSEpngnqsyvstEG 141 zebrafish
NP_001096342  79 KAVQRIVQSHLQSLG-----------SLSDSDD---------------------------EDGDHEGDs--------gDG 112 tropical clawed...
AAI70624     156 SLDSLVSDGNTQTCEPK 172 tropical clawed frog
XP_001370926 114 SRGCQGEEEEEEEEEEE 130 gray short-tailed opossum
AFE80421     115 GYPREEDEEEEEDDEEE 131 Rhesus monkey
XP_015217647 131 SPCTPAESPEETKSDPE 147 spotted gar
1_pfamImport 121 SPCTPAESPEDGQRSPQ 137
NP_001268852 152 TAPTDEEEEEEEEEEEE 168 zebrafish
XP_019213254 131 AAPTKAADRQETAATEQ 147 Nile tilapia
NP_001002538 142 QPGSSGAGGNTAESSGS 158 zebrafish
NP_001096342 113 IGQSTHESPETEVCGSE 129 tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap