Conserved Protein Domain Family
KRE9

?
pfam05390: KRE9 
Yeast cell wall synthesis protein KRE9/KNH1
This family contains several KRE9 and KNH1 proteins which are involved in encoding cell surface O glycoproteins, which are required for beta -1,6-glucan synthesis in yeast.
Statistics
?
PSSM-Id: 398842
Aligned: 34 rows
Threshold Bit Score: 142.075
Threshold Setting Gi: 238848011
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002554398   179 SSLSTVPYTQQTYRTRFAPMQMQPGSTITATTWTRRFPTSAVTYYSTLRNwkSLEQLSTITPGWSYTISSDFNYATPMPF 258 Lachancea the...
CCE79879       155 SSLHSVPYTKQTGVVRYAPMQSQPGSKVTHSTWSRRFPTSSVSYYSTYRS--RPNVLTTTTIPWTYSRTSAANWASTAAF 232 Millerozyma f...
EDK44494       164 SKSFTVPYTLQTGKTRFAPMQMQPGSTVTATTWTRRFPTSAVTYYTTKSK--SPVVMSTITPGWSYTMSSDVNWASVAPY 241 Lodderomyces ...
XP_001486016   170 SKSFSITYTLQTGKTRYAPMQMQPGSTITHSKYSTRYPTSAVTYYSTKAK--SPVVYSTITPGWSYSRKSYTNLATAQLF 247 Meyerozyma gu...
EEQ37475       164 SASFTVPYTLQTGTWRFAPMQLQPGTTVTHTAYSTRHPSSAYTPFTSISP--SPNVYSTITPGWSYSVVSKINSAPVAPY 241 Clavispora lu...
Q5ANN9         167 SKSFTVPYTLQTGKTRYAPMQMQPGTKVTATTWSMKFPTSAVTYYSTKAG--TPNVASTITPGWSYTAESAVNYASVAPY 244 Candida albicans
XP_007373106   166 SAWFTIPYTKQTGKTRYAPMQTQPGSKVTATTWTMRFPTSSVSYYTTKAK--SPVVYSTITPGWDYTAESAVNYATVAPY 243 Spathaspora p...
ABN64556       172 SSLFTIPYTMQTSTKRFAPMQTQPGSKVTATTWSIKYPTSAVTYYTTKGP--KPVVMSTITPGWDYTPTSLPNAASVAPY 249 Scheffersomyc...
XP_013934134   158 SAWFTIPYTKQTGKTRYAPMQTQPGSTVTATTWSRRFPASSVTYYSTISG--TPVVHSTITAGWSYTMSSLTNYATPAPF 235 Ogataea parap...
ybcl:Ecym_2770 163 lpssAVNYVSQTGRIFVAPMQLQPGSTVTAKTWTRRFPTSQVSYYTTKGP--VPSRVSTITPGWSYTIESGVNAETPALM 240 Eremothecium ...
XP_002554398   259 PSQNGGWYNPKSRQSLSTRIRNL 281 Lachancea thermotolerans CBS 6340
CCE79879       233 PTE---FYPASSRVTKASLSTAA 252 Millerozyma farinosa CBS 7064
EDK44494       242 PTY---WYPASQRVSTASITATK 261 Lodderomyces elongisporus NRRL YB-4239
XP_001486016   248 ETS---HYAASDKVKQATLSAGD 267 Meyerozyma guilliermondii ATCC 6260
EEQ37475       242 PTY---YYPASSRVSQASLSSAR 261 Clavispora lusitaniae ATCC 42720
Q5ANN9         245 PTY---WYPASERVSKATISAAT 264 Candida albicans
XP_007373106   244 PTN---WYPASERVSKATLSSAT 263 Spathaspora passalidarum NRRL Y-27907
ABN64556       250 PSY---FYPASDRVSKATLSAAT 269 Scheffersomyces stipitis CBS 6054
XP_013934134   236 PSEVG-WYAPSKRLQSATLDSSy 257 Ogataea parapolymorpha DL-1
ybcl:Ecym_2770 241 PKDNGGWYEPARRVSLKPQKVNV 263 Eremothecium cymbalariae DBVPG#7215
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap