Conserved Protein Domain Family
DegS

?
pfam05384: DegS 
Sensor protein DegS
This is small family of Bacillus DegS proteins. The DegS-DegU two-component regulatory system of Bacillus subtilis controls various processes that characterize the transition from the exponential to the stationary growth phase, including the induction of extracellular degradative enzymes, expression of late competence genes and down-regulation of the sigma D regulon. The family also contains one sequence from Thermoanaerobacter tengcongensis which is described as a sensory transduction histidine kinase.
Statistics
?
PSSM-Id: 398838
Aligned: 59 rows
Threshold Bit Score: 133.36
Threshold Setting Gi: 315592032
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Hore_21830        12 EKILEKTVEVLAESKKEIFTIAESIRREYDNIKRELDLINEEINEVVAKVDKLQEVNRIARIRLMEVSRDFEKHSEYDIK 91  Halothe...
WP_015359221          10 NKIIRDTIKMIDRSREAIYDIAEGARIECERLRRDLEELRIEVERIIKKNDELEIALKKSRERLAMVSSNFDKYSQDDIR 89  Thermoc...
WP_015925317          12 NEIISKTIKSLKSGKNEIIEIAENSRKECKRLEDELVTLKSQVFEIVSVIENLEHDLKQSKKKLYDVNKDFNSHSQNELA 91  Ruminic...
WP_014255410          12 DRIVKKTIEAINNSKTELFEIAENARKECERLKRELEELKERAALLIDDVEFLESELKQVKRQLMIINKNYDKYTEEEAK 91  Hungate...
jgi:Cthe_1268         13 DKIIKKTIEAINNSKAELFDIAENARNECVRLEKELEELKRRTSEIIKSVETLEVALYESKKRLMHVSRNYDKYSEEELR 92  Hungate...
Q8R9D3                14 ENIVEKTIEVIESSKQQIFEILEKAKDEARKLEAQLEELKVQVINVIKEVEMCEKKEKKCRLKLALVSKQFGHLSEQAIK 93  Caldana...
goetting:EAL2_c09870  14 kNVLDGVVQSIQNGQDEIFEISENIRRDCEDSKVQLEKLKKDISRVITEVELLTIEEKKSRRKLLDVSRRFGANSEEQIK 93  Peptocl...
WP_013362141          12 DKVINDVILSIQSGQEEIFNISENVLKECELILQEIEKFKLKVLVVIKEAEKLTKEEKESRQKLFLVSKNIGEYSESDIR 91  Acetoan...
WP_012159052          12 tKIIQRTMEAIAEGKKDIFEISEASRKEYNNLKKELEDFQVKVKSILKEVELLEQQEQISRKVLLAVSRNFATHTEEDIR 91  Alkalip...
jgi:Amet_3142         17 NEILQKTVDTIEDGKSEVFEIAENARKQCHDLQQELKEMKEKASHLIKEVDHLELLERQSRRKLVLVSKEFSKYAEEDIK 96  Alkalip...
jgi:Hore_21830        92 YAYQQAEDTSVQIAVLREKEEQLKKRRAELENRLINLKRNIEKAENMVSRVGVVHDYLLGELSNLSEQFDDLRQKQQLA 170 Halother...
WP_015359221          90 IAYEQADKIRVELAVNREREKFAIIRRNELERRLREASKTVRKAEQLINQVGTVMEYLSGDLKDLNMQLEDVEKRKYLa 168 Thermocl...
WP_015925317          92 QAYQSADNIRVELAVRREQETFLIRRRNDLEIRIRDCLKTLERADSLIGHVGIALDYLSGDLQNVGEQLDNLQQRQFLG 170 Ruminicl...
WP_014255410          92 QAYEKADSLRIELAIKREQEQYLIRRRNELEIRLKDSIRTAEKADRLISNIGISLSCLTGDLQQVTLQLEDLQQRQIMG 170 Hungatei...
jgi:Cthe_1268         93 EAYENADNIRVELAIKREREQYYIKRRNELEMRLKEAYKTVEKADNLISQIGISLSYLTGDLENVSLQIEDMKQRRLLG 171 Hungatei...
Q8R9D3                94 EAYEEAKEAQIELALKRREEKELIERRNELERKLLDTKAIIEKAEKLSSQINIALNYLNGDLKAMNLQLEQLKDKQALs 172 Caldanae...
goetting:EAL2_c09870  94 RAYEEANECQIRLSIKAEEEKNLIKTRNELEIRMKKNSQMLEKAESYMSKMASVTDFLVADLSGVKDTIELLEDKNSin 172 Peptoclo...
WP_013362141          92 KAYNEAKDKQVQLLLKREEEQNLIRERNQLEIRLKKNYEIVEQAESLMSKMKSVMDFLVSDLMDLGKTISNLEDKTQIG 170 Acetoana...
WP_012159052          92 RAYETANQLQIKLVLKRQEEKELIKRRSDLELRLKNALEILNKSENLMSKVSIAFDFLNGDLKNITDTIEDMNYRSSLG 170 Alkaliph...
jgi:Amet_3142         97 EAYEKANAIQIHLILKRQEEKDLIKRRSDLEMRLKSAYEGLQRAENLAFKIGIALDFLSGNLQDISHTLEDMQEKQFLG 175 Alkaliph...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap