5LW5


Conserved Protein Domain Family
Peptidase_C21

?
pfam05381: Peptidase_C21 
Click on image for an interactive view with Cn3D
Tymovirus endopeptidase
Corresponds to Merops family C21. The best-studied plant alpha-like virus proteolytic enzyme is the proteinase of turnip yellow mosaic virus (TYMV). The TYMV replicase protein undergoes auto-cleavage to yield two products. The auto-peptidase activity has been mapped to the central part of this polyprotein.
Statistics
?
PSSM-Id: 398836
Aligned: 2 rows
Threshold Bit Score: 158.352
Threshold Setting Gi: 1272615366
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5LW5_B   59 PTLNCLLSAVSDQTKVSEEHLWESLQTILPDSQLsneeTNTLGLSTEHLTALAHLYNFQATVYSDRGPILFGPSDTIKRI 138  Turnip yellow mosai...
Q8UZB6  810 PALDCLLVSCSAASGIPKEDLWATLCHIFPPSDL----VSDLGLSTNHLTALAFTYQWLVTLRSGELVQRHGLLSAPFAF 885  Grapevine fleck vir...
5LW5_B  139 DITHTTGPP----SHFSPGK 154  Turnip yellow mosaic virus
Q8UZB6  886 EITHTPPVPpatvGHFALSA 905  Grapevine fleck virus isolate MT48
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap