Conserved Protein Domain Family
Apo-CII

?
pfam05355: Apo-CII 
Apolipoprotein C-II
Apolipoprotein C-II (ApoC-II) is the major activator of lipoprotein lipase, a key enzyme in the regulation of triglyceride levels in human serum.
Statistics
?
PSSM-Id: 398822
Aligned: 10 rows
Threshold Bit Score: 129.18
Threshold Setting Gi: 149722193
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EHB18934      24 HLPQQDEPTSPHMLTQVQETLFSYWDNAKAAAQGLYEKTCLPTVDRKIRDMYSKSSAAIRTYTGIFTDQILTILQGD 100 naked mole-rat
P12278        24 HESQQDETTSSALLTQMQESLYSYWGTARSAAEDLYKKAYPTTMDEKIRDIYSKSTAAVSTYAGIFTDQLLSMLKGD 100 dog
XP_006142131  24 PESRQDEPASPALLAQMRESFSSYWDSAKAAAQDLYQKTYLPAVDEKIRDMYSKSTAAVTTYAGIFTDQLFSMLKGE 100 Chinese tree shrew
EGW05332      24 QGLQQDDPGSPALFGKVQESISSYWDTAKAAAQELYQKTYLTSVDEKLRDMYSKSSAAMSTYAGIFTDQLFTLLKGE 100 Chinese hamster
Q05020        21 QGNQEDDSGSLALLGTVQGSLLSYWTSAKEVAKDLYQKTYPISMDEKLRDMYSKSSAAMSTYAGIFTDQLLTLLRGE 97  house mouse
XP_001502426  24 HEPQEDEAASTPLLTKVQESLLSYWDSAKTAAQDLYKKTSLTTVDEKIRDMYSKSTAAVSTYAEILTDQFLSLLKGD 100 horse
XP_003406552  24 lrPQAEEADGSTFLTWVQKSLRRYWDAAKTTAEGLYQKTALPTVNEKIGDMYTKCTSAATTYLGILTDQIVSIVKGE 100 African savanna el...
P19034        24 HVPQQDEASSPALLTQVQESLLGYWDTAKAAAQKLYKKTYLPAVDEKIRDIYSKSTAAVTTYAGIITDQVFSVLSGK 100 cattle
NP_001170799  24 HVPPQDEPDSPALLTKVQESLYGYWDTAKATAQDLYRKTYLPTVDEKIRDMYSKSTAAVTIYAGIFTDQVLSLLTGD 100 pig
XP_003997697  24 dMARQDEATGPTLLSKMQESLYGYWGSAKAAAQDLYKKTYLTTVDEKIRDMYSTSTAAVRIYTGILTDQILSMLSGD 100 domestic cat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap