1QDP,2ROO


Conserved Protein Domain Family
Atracotoxin

?
pfam05353: Atracotoxin 
Delta Atracotoxin
Delta atracotoxin produces potentially fatal neurotoxic symptoms in primates by slowing he inactivation of voltage-gated sodium channels. The structure of atracotoxin comprises a core beta region containing a triple-stranded a thumb-like extension protruding from the beta region and a C-terminal helix. The beta region contains a cystine knot motif, a feature seen in other neurotoxic polypeptides.
Statistics
?
PSSM-Id: 398821
Aligned: 7 rows
Threshold Bit Score: 47.5619
Threshold Setting Gi: 226438097
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1QDP_A   1 CAKKRNWCGKNEDCCCPMKCIYAWYNQQGSCQTTITGLFK-KC 42 
P81885   1 CSRSDGWCGKTEDCCCPMKCIKAWYKQNGNCQNTISAIWK-NC 42  Hadronyche versuta
Q75WG5  27 CARKRAWCEKTENCCCPMKCIYAWYNGQSSCDHTISTIWT-SC 68  Macrothele gigas
P0C1R3   1 CAKKRNWCGKNEDCCCPMKCIYAWYNQQGSCQSTITGLFK-KC 42  Hadronyche sp. 20
P83608   1 CAKKREWCAKTEDCCCPMKCIYAWYNEQSSCQTTFSGMFK-KC 42  eastern mouse spider
P83560  63 CGSKRAWCKEKKDCCCGYNCVYAWYNQQSSCERKWKYLFTgEC 105 Macrothele gigas
2ROO_A   1 CGSKRAWCKEKKDCCCGYNCVYAWYNQQSSCERKWKYLFTgec 43 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap