1IJG


Conserved Protein Domain Family
Phage_connector

?
pfam05352: Phage_connector 
Click on image for an interactive view with Cn3D
Phage Connector (GP10)
The head-tail connector of bacteriophage 29 is composed of 12 36 kDa subunits with 12 fold symmetry. It is the central component of a rotary motor that packages the genomic dsDNA into pre-formed proheads. This motor consists of the head-tail connector, surrounded by a 29-encoded, 174-base, RNA and a viral ATPase protein.
Statistics
?
PSSM-Id: 147504
View PSSM: pfam05352
Aligned: 4 rows
Threshold Bit Score: 405.015
Threshold Setting Gi: 75078321
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1IJG_I   8 TYRS----INEIQRQK----RNR--WFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIHQFGYVGFYKDPVISYIACN 77  Bacillus virus phi29
Q37891   7 SYKS----INDIQRMR----GNR--WYYHYYQYLCSLAYQLFEWERLPPSVDPSYLEKSIHQFGYVGFYKDPRIGYIACQ 76  Bacillus virus B103
Q37995   2 SYKNykrhLGKIELNKetveRNRlaFFEFYFNYFYNIVVNYFTWEGLPNDIDELFIEKKLIENGHVAFFHDDTFGYIAQG 81  Streptococcus phage Cp-1
Q9FZW5   7 SYKT----IGEIQRRR----GNL--WFRTYQRYLFSLAYQMFEWQGLPKTVDPIFLEKQLHQRGFVAFYKDEMYGYLGVQ 76  Bacillus virus GA1
1IJG_I  78 GALSGQRDVYNQATVFR---AASPVYQKEFKLYN----YR---DMKEEDMG------VVIYNNDMAFPTTPTLELFAAEL 141 Bacillus virus phi29
Q37891  77 GALSGTVDHYNLPDRFH---ASSVGYQNTFKLYN----YS---DMKEKNMG------VAIYNNDLKCSTLPALEMFAQDL 140 Bacillus virus B103
Q37995  82 GTRGERLNHYDQPLTYQpvnASSMNYFKQMEIAYtendFRvieELHKDNPDkikrpcIVIPNNNFYEPYIGYLELFCEKL 161 Streptococcus phage Cp-1
Q9FZW5  77 GTLSGQINLYNQPNFYT---ASAPTYQKSFPLYW----YDmgeDLNEKGQG------IVIYNNLERMPTLDILNLYAMNL 143 Bacillus virus GA1
1IJG_I 142 AELKEIISVNQNAQKTPVLIRANDNNQLSLKQVYNQYEGNAPVIFAHEALD----------SDSIEVFKTDAPYVVDKLN 211 Bacillus virus phi29
Q37891 141 AELKEIIAVNQNAQKTPVLIAANDNNQLSLKNIYNQYEGNAPVIFVHESLD----------LDNLKVFKTDAPYVVDKLN 210 Bacillus virus B103
Q37995 162 ADIELTIQLNRNAQITPYFIFADNTNVLSMKNIFNKIANFEPVVYLNKQKDqdgqdsfkqlSDYIQVFRTDAPFLLDKLH 241 Streptococcus phage Cp-1
Q9FZW5 144 AELKETIYVNQNAQKTPVIIKAGDNDLFSMKQVYNKYEGNEPVIFAGKKFN----------TDDIEVLKTDAPYVADKLT 213 Bacillus virus GA1
1IJG_I 212 AQKNAVWNEMMTFLGIKNANLEKKERMVTDEVSSNDEQIESSGTVFLKSREEACEKINELYGLNVKVKFRYDIV 285 Bacillus virus phi29
Q37891 211 AQKNAVWNEVMTYLGIKNANLEKKERMVTSEVDSNDEQIESSGNIYLKARQEACNKISELYGLNLKVKFRYDIV 284 Bacillus virus B103
Q37995 242 DEKLRVMNQLLTFIGINNNPSDKKERLVVSEAISNNGVISANIEVGWKSRRKFVELINKCYGLEISVKPAETIQ 315 Streptococcus phage Cp-1
Q9FZW5 214 MLFKDQWNEAMTFLGLSNANTDKKERLIQSEVESNNDQIQGSANIYLAPRQEACRLINEYYGLNVSVKLRKELV 287 Bacillus virus GA1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap