5T4X


Conserved Protein Domain Family
GMP_PDE_delta

?
pfam05351: GMP_PDE_delta 
GMP-PDE, delta subunit
GMP-PDE delta subunit was originally identified as a fourth subunit of rod-specific cGMP phosphodiesterase (PDE)(EC:3.1.4.35). The precise function of PDE delta subunit in the rod specific GMP-PDE complex is unclear. In addition, PDE delta subunit is not confined to photoreceptor cells but is widely distributed in different tissues. PDE delta subunit is thought to be a specific soluble transport factor for certain prenylated proteins and Arl2-GTP a regulator of PDE-mediated transport.
Statistics
?
PSSM-Id: 398820
Aligned: 53 rows
Threshold Bit Score: 145.793
Threshold Setting Gi: 124442970
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5T4X_A        30 DILRGFKLNWMNLRDAETGKILWQGTEDLSVP-GVEHEARVPKKILKCKAVSRELNFSSAEQMEKFRLEQKVYFKG--QC 106
XP_001303980  15 RILKGFKLISLTLKNSSNGKVAWTSKDWTDDVfSAVKDAHLPKEMLGYPAVGREIVFSTEEAIKEFRIQQDILVHG--QN 92  Trichomonas vag...
XP_002504708  17 KIAAGFTIDGMNMRDASTGEMLWEMNSWPSDWhVAEIQARVPARILQCPVVSRELTFSSVEKVANLRCEHRVYLDGapDP 96  Micromonas commoda
EEY61295      76 KVCKGLTINHMNMRCADTGRLMWQSEEWGEDIyRVEQKARLPVAILKCSAVSREINFSSVEEITKFRLEQRVFLAG--SC 153 Phytophthora in...
XP_009011300   6 SILQGFKLNWMNLRDADSGKVLWQSTDDLSIPd-IEHEARVPKKILKCRAVSREINFSSIEELTKFRLEQRVLFKD--KC 82  Helobdella robusta
EFX81991       7 DILSGFRVNWMSLREVDTGKLLWQNSDDLSQPd-VEHEARVPKSILNCRAVSREINFSSIEPLENFRLEQKVLFKG--RA 83  common water flea
ETN68155      11 KILNGFQINWMILRDADTGKIIWQENKDFSCPe-VEHEAKVPVKILSLRAVSREINFSTVEAMENFRLDQKVLFKG--RI 87  Anopheles darlingi
BAH71878       7 DILNGFQVNWMNLRDADTGVVLWQGTEDLSLPd-KEHEAKVPKKILKCRAVSREINFSSVEPMEKLRLQQKVLFKG--RC 83  pea aphid
XP_003385303  12 KILDGFKLNWMNLRDAENGKIMWQSYDNLSVPg-VEHEARVPKKILKCSQVSREINFSSEQELTNLRLQQNIYFKD--KL 88  Amphimedon quee...
XP_018646336  11 SILKGFKLNWMNLRDADSGKILWQSTDDFSIPe-IEHKAHVPRKILKCKSVSREINFSSKEQLENFWLEQEVFLRD--QS 87  Schistosoma man...
5T4X_A       107 LEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVSTSKVRLFY 169
XP_001303980  93 IEQWNYKFGFVIPGSENSWETIVEAAGEGNMLPAEYLSGNMYILTSFYAGNLFISRSVVRVFY 155 Trichomonas vaginalis G3
XP_002504708  97 IEVWDFDFGFVMPGSRNTWQTTVEAAGGEKMLSPTEASGRVTVRTKFTDGDATIVESAVRVFY 159 Micromonas commoda
EEY61295     154 IEEWIFNFGYVIPGSTNTWQQTIESAGSENMLNPEVMSGKLTIETAFYDGQLSIAKTVYRIYY 216 Phytophthora infestans T30-4
XP_009011300  83 IEEWFFDFGFVIPCSTNTWQSIIEAAPEGQMIPASVLSGHVVIETKFFDDQILVSQSRVRIFY 145 Helobdella robusta
EFX81991      84 LEEWTFDFGFVIPNSTNTWQSIIEAAPESQMMPAQILNGNVTIETKFYDDTLLVSTSLVRLFY 146 common water flea
ETN68155      88 MEEWFFEMGWVSPNTTNTWQSTIEAAPESQMMPAKVLNGNVTIETSFYDGETLISKSVVRLYY 150 Anopheles darlingi
BAH71878      84 LEEWYFEFGFVIPNSTNTWQSLIEAAPESQMMPANVLNGNIVIETNFYDDDLLISSSKVRLYY 146 pea aphid
XP_003385303  89 IEEWSFEFGFVIPSSTNTWQSIIEAAPESQMIPASLLSGNVVIETEFFDGNLLISTSRVRLHY 151 Amphimedon queenslandica
XP_018646336  88 IENWSFEFGFVIPGSTNTWQSLIQSDSADRMIPAKVLSGNVVIVTHFYDGDLLVSKSKVRIFY 150 Schistosoma mansoni
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap