5OY4


Conserved Protein Domain Family
GSK-3_bind

?
pfam05350: GSK-3_bind 
Glycogen synthase kinase-3 binding
Glycogen synthase kinase-3 (GSK-3) sequentially phosphorylates four serine residues on glycogen synthase (GS), in the sequence SxxxSxxxSxxx-SxxxS(p), by recognising and phosphorylating the first serine in the sequence motif SxxxS(P) (where S(p) represents a phosphoserine). Interaction of GSK-3 with a peptide derived from GSK-3 binding protein (this family) prevents GSK-3 interaction with Axin. This interaction thereby inhibits the Axin-dependent phosphorylation of beta-catenin by GSK-3.
Statistics
?
PSSM-Id: 398819
Aligned: 8 rows
Threshold Bit Score: 271.052
Threshold Setting Gi: 92058701
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5OY4_X         4 RREEEEEAGEEAEge--eeEeDSFLLLQQSVALGSSGEVDRLVAQIGETLQLDAAQHSPASPCGPPGAPLRAPGPLAAaV 81 
1_pfamImport   1 KRKRCEQARGRAEr-----R-TSFLLLEQSVTLGGSGEVDRLVAQIGETLQLDAAQDSPASPCAPPGRHSSSPRGLGA-V 73 
XP_581986      4 RREEEEEAGEEEEe-----E-DSFLLLEQSVTVGGSVEVDRLVAQIGETLQLDAAQDRPASACAPPGPPLQPPRSPAA-V 76  cattle
XP_005343099   4 RREEEEEAGEEAEgeeeddD-DSFLLLKQSVTLEGSGEVDRLVAQIGQTLQLDAAHDSPASRCVPPGPPLQPP---VA-L 78  thirteen-lined ...
P70339         4 RREEEEEAGDEAEge--edD-DSFLLLQQSVTLGGSTDVDQLIVQIGETLQLDAAHDRPASPCAAPGPP--PPQVLAA-L 77  house mouse
EGW12134       4 QRAEKEEGGFEAEge--dkD-DSFLLLQQSVTLGSLTDVDQLIALIGETLKLDTAHDGPASPSAAPGPP--PLRVLAA-I 77  Chinese hamster
O75474         4 RREEEEEAGEEAEgee-eeD-DSFLLLQQSVTLGSSGEVDRLVAQIGETLQLDAAQDSPASPCAPPGVPLRAPGPLAAaV 81  human
XP_003787348   4 RREEEEEAGEEAEge--eeK-DSFLLLEQSVTLGSSGEVDKLVAQIGETLQLDAAQDSPASPCASLGAPLRAPRPQAA-V 79  small-eared galago
5OY4_X        82 PADKARSPAVPLLLPPALAETVGPAPpGVLRCALGDRGRVRGRAAPYCVAELATGpsalsplppqadldgppgAGKQGIP 161
1_pfamImport  74 RADKAWSPGVPLLRRLSLAEAVDGSP-GAVRCALGDRAPLLRRSAPYCLVRAGRG------------------FGKQGIP 134
XP_581986     77 RADKARAPAQPLLLPAASIEAGGPAPlGALRCALGDRGRVRGRAAPYFVAELAAGptalsplppqpsldgplgADKRGSP 156 cattle
XP_005343099  79 PADKARSPAVPLLLRPVSAEAGGLAPpGALRCALGDRGRVRGRAAPYCVAELSSGpsalsplssqpgldgppgAGKQGIP 158 thirteen-lined ...
P70339        78 PADKTGTPARRLLRPTGSAETGNPAPpGAVRCVLGERGRVRGRSAPYCVAEISPGasalpqqp---gldgppgTGKLSTP 154 house mouse
EGW12134      78 SVEQNRSPSRQMLRSSVPAETGAPAHpRAISCMLWERWRLRSQAAPYCVAELTAVtsalcpvsrqpglegppvTGKPSTP 157 Chinese hamster
O75474        82 PADKARPPAVPLLLPPASAETVGPAPsGALRCALGDRGRVRGRAAPYCVAEVAAGpsa---------------------- 139 human
XP_003787348  80 RADEGPAAAVQLLLPPSSSEGVGPAPpGALRCALGDRGRVRGRAAPYCVAELVAGpsalptlplqpgqdgplgAGKRGVS 159 small-eared galago
5OY4_X       162 QPLSGPCRRGWLRGAAASRRLQQRRGSQPETRTG-DDDPHRLLQQLVLSGNLIKEAVRRLHSRRLQLRAKLPQRPLLGP 239
1_pfamImport 135 QPLSGPCRRGWLRGAASSRRLQQRRGSQPETRTS-DDDPHRLLQQLVLSGNLIKEAVRRLHSRRLQLRPKLPPCQLPGP 212
XP_581986    157 QPLSGPCRRGWLRDAAASRRLQHRRGLQPPARNG-DDDPHRLLQQLVLSGNLIKEAVRRLHSRRLQLHAKLPQRQLLGP 234 cattle
XP_005343099 159 QPLTGPCRRGWLRSAAASRRLQQRRGSQPDTCTG-DDDPHRLLQQLVLSGNLIKEAVRRLHSRRLQLHAKLPQHRLLGP 236 thirteen-lined g...
P70339       155 QPLSGPCRRGWLRNAAASRRLQQRRGSQPETRTGdDDDPHRLLQQLVLSGNLIKEAVRRLHSRQLQLHAKLPAHPFLGP 233 house mouse
EGW12134     158 QPLSGPCRRGWPQSTAMSLPLQQRPGSQPETHTS-DDDPHQLPQQLLLSGNLIKEAVQRLHSLQLQLQANLYSHRFLKr 235 Chinese hamster
O75474       140 --lpGPCRRGWLRDAVTSRRLQQRRWTQAGARAG-DDDPHRLLQQLVLSGNLIKEAVRRLQRAVAAVAATGPASA-PGP 214 human
XP_003787348 160 QQLSGPCRRGWLRGAAASRRLQQRRGSQPETRTN-DDDPHRLLQQLVLSGNLIKEAVRRLHSRRLQLHTKLPQRPLLGP 237 small-eared galago
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap