Conserved Protein Domain Family
DUF747

?
pfam05346: DUF747 
Eukaryotic membrane protein family
This family is a family of eukaryotic membrane proteins. It was previously annotated as including a putative receptor for human cytomegalovirus gH but this has has since been disputed. Analysis of the mouse Tapt1 protein (transmembrane anterior posterior transformation 1) has shown it to be involved in patterning of the vertebrate axial skeleton.
Statistics
?
PSSM-Id: 398815
Aligned: 109 rows
Threshold Bit Score: 199.658
Threshold Setting Gi: 74832551
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ESS29572                 3109 LAPADVCALVRFSLLVASVSLFLL--V-DT------SRVYHYIRAQPFMKLYVVFNMLELFEKMWRSLGRDIFDALMRTT 3179 T...
EFC49106                  345 vnesVLFDLVKFFCLVINIILIMQ--TtDY------SLLYHYIRGESILKLYVIGNMLDVFDKLCSSFGLDSQIALLYSS 416  N...
WGS:AAFB:cds.EHI_100500A  120 iHYKRIYDILMYLSTLFCVIIIYQ--V-DI------GFVYHYIRAESVLKLYALYNALGMLNSLLSAFTFDIHSSLLISI 190  E...
XP_001614494              700 LSFPEYSGLIRMSLILICIYIFSF--V-DT------SRIYHYIRAQPFMKLYVVLNMLEIVERLLRSLGKDLIDNMIRTF 770  m...
CAX64442                  785 LSFPEYSGIIRLSLILICIYIFSF--V-DT------SRIYHYIRAQPFMKLYVVLNMLEILERLLRSLGKDLIDNMIRTF 855  P...
Q4N5K5                    220 ITLTEVCGCVRFLVLLATVYIFSF--I-DT------SKVYHNIKAQPIMKLYVLFNMLEICERLCRSFNRDIMDSLVKTT 290  T...
XP_001609992              259 ITPIEACGFARFAAMLFAIIILSR--I-DT------SRVYHNIRGQPFFKLYVIFNMLEICERLCRSFGRDCIDTLMRTT 329  B...
Q4QIS9                    122 wrrcELRDIITLLVLTIT--LGSYwvA-DLattqlySYLYHAVRRTSFIKVVMIFSILDVADKILSSFSQDSLEVLYAAV 198  L...
Q4D3C1                     83 fPRLERRDIVALVLIVVG--MLTYcsL-SLyathlyAYLYHVVRRTSFIKLVMVFNILEVVDRLLSALSQEVIEVLTISV 159  T...
Q582A2                    164 vHRFERRDAVALVLIVVG--VLTYtlL-SFktvelyAYLYHAVRRTSFIKLMMVFNILEVADKLLSALSHEATEVLTACV 240  T...
ESS29572                 3180 Vqllsrpvqassastadegeentetaerkeetrssvlafphtwkrhqreseegrvcrdeggrnrkeaegreekrrghrqe 3259 T...
EFC49106                  417 Kqfvng-------------------------------------------------------------------------- 422  N...
WGS:AAFB:cds.EHI_100500A  191 K------------------------------------------------------------------------------- 191  E...
XP_001614494              771 Iriinlrsyvyivrnhytskegereaggvpgmaehgsggvpsggvspggalqggkkatfpaaspttttngattggpstqa 850  m...
CAX64442                  856 Iriinlrsyiciirnnynekssinsnsnyinyvhndnygvnsyiyknkdnnnelitfdntrhinvftnknkdnllnnnnn 935  P...
Q4N5K5                    291 Inifiiqfnntnvssarvnfqkpdsqkcqlgnngnksflnsht------------------------------------- 333  T...
XP_001609992              330 Vkiyklcsnfslrssnalamlnatkrmksgiamdhfmtkkykssvvisnfarveqmatptmrrvtvdvagysertis--- 406  B...
Q4QIS9                    199 Ddeyayrcahrcqtkpaagdtpmnraa----------------------------------------------------- 225  L...
Q4D3C1                    160 Qnwdkkhpqhpr-------------------------------------------------------------------- 171  T...
Q582A2                    241 Gdwrgaaqtcge-------------------------------------------------------------------- 252  T...
ESS29572                 3260 eekenesafrsredrerelefiiggenkesssegssaflkcradvrttpetdetngrllktedgdeemeresrlfsvfre 3339 T...
EFC49106                      --------------------------------------------------------------------------------      N...
WGS:AAFB:cds.EHI_100500A      --------------------------------------------------------------------------------      E...
XP_001614494              851 ehypetnatptrehpnqgeapp---------------------------------------------------------- 872  m...
CAX64442                  936 nmnymn-------------------------------------------------------------------------- 941  P...
Q4N5K5                        --------------------------------------------------------------------------------      T...
XP_001609992                  --------------------------------------------------------------------------------      B...
Q4QIS9                        --------------------------------------------------------------------------------      L...
Q4D3C1                        --------------------------------------------------------------------------------      T...
Q582A2                        --------------------------------------------------------------------------------      T...
ESS29572                 3340 stgqageeafvephallkrhtwagdferecwtflahtevhdsprispksrgetsqdagesqafkqtspvhagkatsqmaq 3419 T...
EFC49106                      --------------------------------------------------------------------------------      N...
WGS:AAFB:cds.EHI_100500A      --------------------------------------------------------------------------------      E...
XP_001614494                  --------------------------------------------------------------------------------      m...
CAX64442                      --------------------------------------------------------------------------------      P...
Q4N5K5                        --------------------------------------------------------------------------------      T...
XP_001609992                  --------------------------------------------------------------------------------      B...
Q4QIS9                        --------------------------------------------------------------------------------      L...
Q4D3C1                        --------------------------------------------------------------------------------      T...
Q582A2                        --------------------------------------------------------------------------------      T...
ESS29572                 3420 sqlpsfsgpyhsspsrssrshsahsashsssrsssascvgrrgtlrhsaghldaagflsprspavllvasssasvacsve 3499 T...
EFC49106                      --------------------------------------------------------------------------------      N...
WGS:AAFB:cds.EHI_100500A      --------------------------------------------------------------------------------      E...
XP_001614494              873 ---------------------------------------sddqaaskpagicpvgndaqdvemcrsevssaprhnhipsq 913  m...
CAX64442                  942 -------------------------------------------------------ymykdsviknkheyengyvtnmdkd 966  P...
Q4N5K5                        --------------------------------------------------------------------------------      T...
XP_001609992              407 ----------------------------------------------------------------qsetthpysnagtsdl 422  B...
Q4QIS9                        --------------------------------------------------------------------------------      L...
Q4D3C1                        --------------------------------------------------------------------------------      T...
Q582A2                        --------------------------------------------------------------------------------      T...
ESS29572                 3500 apaqeaagslnirrgregasgegpgerreqekadperrastacsrssrasgklsvqtgveWNKWML----WVAQYLLVLA 3575 T...
EFC49106                  423 --------------------------------------------------------ilndRSGSWKefghMTVMFIFHMI 446  N...
WGS:AAFB:cds.EHI_100500A  192 ------------------------------------------------------------NKKMSD----SILFFILTVF 207  E...
XP_001614494              914 nqnqnqnanqnqnpnqlspnereknkidclknnkdkdkdkdkdkddqtnkkfkipifypfYSILIK----FIVQYIFVLT 989  m...
CAX64442                  967 ifsnnfymnnirhhadsfyyqnelnsfnlnknkennvrffnnendkkknnkskisilfpfYSVVLK----FTIQYIFVLA 1042 P...
Q4N5K5                    334 -------------------nntqnhpnksvnrrssldsegfvpgnktesllsscrnhvdgFNIYYK----FVFLYCFVVL 390  T...
XP_001609992              423 sdkerpiktlsfvgddldlhlnhsedspekhsfvlkdlsatldtiadtvcpdstreledsGNAYLE----FILRFLLVTI 498  B...
Q4QIS9                    226 --------------------------------------------fggacagrddagyanarqhtppsrwlLAGSAIAACI 261  L...
Q4D3C1                    172 -----------------------------------------------------------pevlfthslwlPVGSAILSVV 192  T...
Q582A2                    253 ------------------------------------------------------------qcerfaatwlPVLSAVVAVV 272  T...
ESS29572                 3576 YVLVHTCMHLIRVLSLNIAINSSESAMFLIVVTNNFGEIKSSVFKKFSPTTLYSIVAADVVERFQLCCDAFIVSLKLATA 3655 T...
EFC49106                  447 YLYVHSIVQLIRIVTLNAALNSSNYTLLTMIISTNFVELKGSVFKRFTKENLFQLASSDVVERFEIFWFTILIFVQNTLR 526  N...
WGS:AAFB:cds.EHI_100500A  208 ITLLHSFNLFFYIMALNVAINSKGHALLALLVSNNILELKSSVWKRMFPENVFQVLCADILELFELFSFVILLSLSNFGY 287  E...
XP_001614494              990 YILTHAFAHLIRFLSLNIAINSSESTMFLILVMSNFTEIKSTVFKKFSKTSLFTIVASDAVERFYLFIDAFLVLLKMSTA 1069 m...
CAX64442                 1043 YILIHAFMHLVRFLSLNIAINSSESTMFLILVMSNFTEIKSTVFKKFTKISLFTIVASDAVERFYLFIDAFLVLLKMSTA 1122 P...
Q4N5K5                    391 TITFHAFIHLVRVLILNIAINSPEYTMFLVLITNNFGEIKSSVFKKHTQLSLFIIFASDAVERCHLVLDGLLVFFKMSTS 470  T...
XP_001609992              499 YIIFHSFMHLLRVLILNIAINSSDSAMFLLMVTNNFAEIKSTVFKKFNETSLFTIVATDAIERFHLCFDGMIVFFKMCTV 578  B...
Q4QIS9                    262 STSCHSLSLLLHVVTLNVAINAEGNSLLALLVGNNFTELKSVVLKKNTPESLQSVCALDALERMQYVVFFLVMLLHHMHE 341  L...
Q4D3C1                    193 CVAAHAVTLLLSVVTLNVAVNAEDRLLLALMVGTNLSEVKGAAYKKYNRESLLQVTAADAVERFKFLLFVLVMALQHMHE 272  T...
Q582A2                    273 SVAAHAVVLLLSVVTLNVAVNSEGNLLLTLIVSSSLSELKGAVYKKHNRESLYSVAAADAIERVKFLLFVLVMVMQHMHE 352  T...
ESS29572                 3656 a------------------------------SPRATSLAAVCSWLCGVFLLEIAVDWVKFLYLVKFNNIQATAFDEYQHV 3705 T...
EFC49106                  527 tivdstsgpvegvdlndfetmtnlegssslfSFLDDKLEEFGHIFIFMICAEILVDTLKHTFVSKFNSIHPSTFRMYTLK 606  N...
WGS:AAFB:cds.EHI_100500A  288 yew--------------------------diESNPDLLISMIYSLFLILLAEVIIDSLKHMFIGKFNNIPLSIYDKGKFV 341  E...
XP_001614494             1070 -------------------------------YRTQNSFFSISSWLIIILLLEVGVDWCKHSYLLKYNKLDSDSLNKYFHT 1118 m...
CAX64442                 1123 -------------------------------YRTQNSFFSISSWLIIILLLEVGVDWCKHSYLLKYNKLDSESLNKYFHT 1171 P...
Q4N5K5                    471 -------------------------------RRNLNSYISVFSWLFLVYGIEVLIDLVKHSYLIKFNKLLSETFEKYDSV 519  T...
XP_001609992              579 -------------------------------QSPWQAYLQVSRWLSKMLVLEVLIDYFKHSFLLKFNKIGGELFKRYTEV 627  B...
Q4QIS9                    342 -----------------------------------RFTDFAVADVFVILCVEVAIDFVKHLFVFRFNGIPPSMFRAYSQL 386  L...
Q4D3C1                    273 -----------------------------------RFHVLDIADMLLVFLGEVFVDFTKHLFVAKFNGISLSVYRTYAQL 317  T...
Q582A2                    353 -----------------------------------RFCGLDFADTLFVLLSEVAVDFTKHLFVAKFNGISLSVYRSFTQL 397  T...
ESS29572                 3706 LLADVLlsrvpqaqrhl------------lpdgnfkvpcrGMYAFSHIPTRRIGFMELPIVTLIIACLP----------- 3762 T...
EFC49106                  607 LCDDLIshsdsakkse---------------ttsvvvssfFHNTNRSKVARRLGFLEGPLITHTLRMIM----------- 660  N...
WGS:AAFB:cds.EHI_100500A  342 LLNDLIstqdg-------------------------lfkiPSLDSTSTSARRLGMPAVPLSVLFICFGL----------- 385  E...
XP_001614494             1119 LLADVLisrtpnnniyy------------mntssfevpckNIFCFAHIPTRRLGYMSMPVVTLIVCSLPrwvlheggskw 1186 m...
CAX64442                 1172 LLADVLisrtpnkniyy-------------mkdsfavpckNIFSFSHIPTRRLGYMSMPVVTLIVCSLP----------- 1227 P...
Q4N5K5                    520 LIADRLlsrslynlrsl-------------tfyklkvpckCSFSFSHISSRRLGFISSPIVTLIISTIP----------- 575  T...
XP_001609992              628 LIGDILlsrslrnlhml-------------vrfdfrvickGVYSFSHIPARRLGFMSSPIMTLIVCNIP----------- 683  B...
Q4QIS9                    387 ALLDLScetvlwrlpslevvasgsgsgvatrmeeaaelltPAFGFAPKNVKRNGFDAIAYAALLLWSCE----------- 455  L...
Q4D3C1                    318 TILDMAaetvlwrlgdnihirc--vdepqlhvdnvktllsASDGFFPKYVKRTGYIPVPYAALLLWSLY----------- 384  T...
Q582A2                    398 TLIDMAaetvlwrlthiraccv---dsalydsqdlrkllrPSDGFFPKYVRRTGFVPVPYAALLLWSFS----------- 463  T...
ESS29572                 3763 -------------------------VVSWTSP-----------------------------STLVYALLGWLCLFVSKVL 3788 T...
EFC49106                  661 -------------------------EVMLPWLfhfvavlgysnnwdsletliaipslskviYPIIITLLGFLCLFLLKLL 715  N...
WGS:AAFB:cds.EHI_100500A  386 -------------------------ETIPPSH-----------------------------FNLLFIISLLLILYLFKIL 411  E...
XP_001614494             1187 dpdsrcmgrqsdyiyahnnlsspplRLNYLYNi----------------------------SHFSFALSIW-------II 1231 m...
CAX64442                 1228 -------------------------RLNYLSNi----------------------------SLFSFALSIWICLFLFKII 1254 P...
Q4N5K5                    576 -------------------------KMGFHISp----------------------------KILIISAFSWLSLFFVKIT 602  T...
XP_001609992              684 -------------------------YIRSRLTv----------------------------TRFVTALLIWTALFFLKVT 710  B...
Q4QIS9                    456 -------------------------RVAGYLLw----------------------------QAPLVCVLLVLILALLKLM 482  L...
Q4D3C1                    385 -------------------------PFVSMMLl----------------------------RAPLLFALSLAILVLLKIL 411  T...
Q582A2                    464 -------------------------PIAHALFr----------------------------NAPLLLLLVLVAVMLLKVF 490  T...
ESS29572                 3789 LSLMIVAFATKRRR 3802 Toxoplasma gondii VEG
EFC49106                  716 ISITIIGHAAKnlc 729  Naegleria gruberi
WGS:AAFB:cds.EHI_100500A  412 LAIALRYLAFTEVT 425  Entamoeba histolytica HM-1:IMSS
XP_001614494             1232 LSVMIVSYTISEKK 1245 malaria parasite P. vivax
CAX64442                 1255 LSIMIVSYTISEKK 1268 Plasmodium falciparum 3D7
Q4N5K5                    603 TSILLTGYCIKKKD 616  Theileria parva
XP_001609992              711 LSILLLSYGIKKRR 724  Babesia bovis T2Bo
Q4QIS9                    483 LSSIVYGMCARftl 496  Leishmania major
Q4D3C1                    412 LSELIRGVATRFvv 425  Trypanosoma cruzi
Q582A2                    491 MSELIHSVSMRFVv 504  Trypanosoma brucei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap