4X8I,6NW5,2FVG,1VHE,3KL9,1VHO


Conserved Protein Domain Family
Peptidase_M42

?
pfam05343: Peptidase_M42 
Click on image for an interactive view with Cn3D
M42 glutamyl aminopeptidase
These peptidases are found in Archaea and Bacteria. The example in Lactococcus lactis, PepA, aids growth on milk. Pyrococcus horikoshii contain a thermostable de-blocking aminopeptidase member of this family used commercially for N-terminal protein sequencing.
Statistics
?
PSSM-Id: 398813
Aligned: 48 rows
Threshold Bit Score: 261.345
Threshold Setting Gi: 81783647
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4X8I_B  45 GNVIAHFKG--SAPKVMVAAHMDKIGLMVNHIDKDGYLRVVPIGGVLPETLIAQKIRFFTEKG--ERYGVVGVLPP--HL 118 Pyrococcus furiosus
P70801  48 dNIIAKIPGknSDIAVAITAHKDEIGAIVKNIGDAGKVEVRKLGGAYPWVYGEGVVDLLGDNE--TISGILSFGSR--HV 123 Nostoc sp. PCC 7120
Q92W97  53 GAIRALRPGaaERPARGIVSHLDTLGAQVKALKENGRLELVSIGHWSARFAEGARASIFSGKG--TYRGSILPLKAsgHT 130 Sinorhizobium meliloti
Q9HYE5  53 GTIRATLQGrlNTPDRAVSAHLDTIGALVREIKPNGRLGLAPVGCWSSRFAEGSRVTVFTEQG--VFRGSVLPLLAsgHA 130 Pseudomonas aeruginosa
Q8R656  53 GALIAYIKGkdSNYKKMISAHVDTLGAVVKKIKKSARLEVTNVGGFAWGSVEGENVTIHTISg-kTYSGTLLPIKAsvHV 131 Fusobacterium nucleat...
Q97L72  48 GNIMATLPGknSSFERTISAHLDTLGAMVKEIKSNGTLSLTPIGGYMMNSIEGENCNIMTLDd-kKYTGTIQSTKPsvHI 126 Clostridium acetobuty...
Q8DQQ2  45 GGVNVTIKGqnDEQHRYVTAHVDTLGAIVRAVKPDGRLKMDRIGGFPWNMIEGENCTIHVASTgeKVSGTILIHQTscHV 124 Streptococcus pneumon...
Q2FYS0  45 GALLITVPGknDEVQRCITAHVDTLGAMVKEIKEDGRLAIELIGGFTYNAIEGEYCQIKTDAGq-IYTGTICLHETsvHV 123 Staphylococcus aureus...
O07603  48 GGLIATLPGrdTSRHRMLTAHVDTLGAMVKEIKADGRLKIDLIGGFRYNSIEGEYCQIETASg-kMYTGTILMHQTsvHV 126 Bacillus subtilis sub...
Q8Y8C6  51 GGLIVTLPGkdETKHRMLTAHVDTLGAMVKEIKADGRLLLTLIGGYRFNAIEGEYCTIETSAg-dLYSGTILMHQTsvHV 129 Listeria monocytogenes
4X8I_B 119 RReAKDQGGKID----WDSIIVDVGASSREEAEEMGFRIGTIGEF---APNFTRLSEHRFATPYLDDRICLYAMIEAARQ 191 Pyrococcus furiosus
P70801 124 SHeSPQKVQQEDtavkWENAWIETK-RTTEELEAAGIRPGTRMVIgkhRKRPVRLQDH-IASYTLDNKASVAILLALVQQ 201 Nostoc sp. PCC 7120
Q92W97 131 FNeEVDTQPTGWr---HIELRVDALARDRNDLVQLGIDVGDIVAI---DPQPELLENGFIVSRHLDDKAGVAIMLAALEA 204 Sinorhizobium meliloti
Q9HYE5 131 FNtEVDNLKISWd---NIELRLDAYTASRADSESLGISVGDYVAF---DPLPEFTESGHISARHLDDKAGVAALLAALKA 204 Pseudomonas aeruginosa
Q8R656 132 YGdVAREMPRTEe---TMEIRIDEDVKTDEDVLKLGILQGDFISF---ETHTRILDNGYIKSRYLDDKLCVAQILSYIKY 205 Fusobacterium nucleat...
Q97L72 127 HN-DAKELKRIPe---NMEVVIDEKVFSKEDVEALGINVGDFICF---DPRIKFTDSGFIKSRHLDDKASAAIMLYAIKH 199 Clostridium acetobuty...
Q8DQQ2 125 YK-DAGTAERTQd---NMEVRLDAKVTSEKETRALGIEVGDFISF---DPRTVVTETGFIKSRHLDDKVSAAILLNLLRI 197 Streptococcus pneumon...
Q2FYS0 124 YR-NNHEIPRDQk---HMEIRIDEVTTSEEDTKSLGISVGDFVSF---DPRTVITSSGFIKSRHLDDKASVAMILQLLKK 196 Staphylococcus aureus...
O07603 127 YK-DAGKAERNQe---NMEIRLDEPVHCRKDTEELGIGVGDFVSF---DPRVEITSSGFIKSRHLDDKASVALLLRLIHE 199 Bacillus subtilis sub...
Q8Y8C6 130 YK-DAGTAERNDk---NMEVRLDVKALDADKVRALGIEVGDFVSF---DPRVQIINDEYIKSRHLDDKASVAILLQLINH 202 Listeria monocytogenes
4X8I_B 192 LGEHE----ADIYIVASVQEEIGLRGARVASFAIDPEVGIAMDVTFA--KQPNDKGKIvpelgkgPVMDVG---PNINPK 262 Pyrococcus furiosus
P70801 202 LKQPA----IDVYLVASAKEEVGAIGALFFTQNQQLDALIALEICPLseEYPVKDSEN-------PVLLVQdayGIYDEG 270 Nostoc sp. PCC 7120
Q92W97 205 MQREKvdtpVDTHWLFTIGEEVGVGASAAIVPE--IASLVAIDNGTTa-PGQNSDEFG-------VTLAMAdqtGPFDYH 274 Sinorhizobium meliloti
Q9HYE5 205 VKESGqeppIDCHPLFTITEEVGSGAAGALPWD--VSEFVGIDIAPVa-EGQNSNEHS-------VSVAMQdsgGPYDFH 274 Pseudomonas aeruginosa
Q8R656 206 LKDNKlkpkTDLYIYFSNYEEIGHGVSV-FPED--LDEFIAVDIGLVagEDAHGDEKK-------VQIIAKdsrSTYDFT 275 Fusobacterium nucleat...
Q97L72 200 FIDNNielkYTTNFYFSTYEEVGHGASN-LPQN--TKELLCIDMGAPg-KGQNSSEFA-------TCICAKdssGPYDYA 268 Clostridium acetobuty...
Q8DQQ2 198 YKEEKielpVTTHFAFSVFEEVGHGANSNIPAQ--VVEYLAVDMGAMg-DDQQTDEYT-------VSICVKdasGPYHYD 267 Streptococcus pneumon...
Q2FYS0 197 LKEEQiilpHTTQFYISNNEEIGYGANASIDSK--IKEYIALDMGALg-DGQASDEYT-------VSICAKdasGPYHKQ 266 Staphylococcus aureus...
O07603 200 IQTEDielpYTTHFLISNNEEIGYGGNSNIPPE--TVEYLAVDMGAIg-DGQATDEYS-------VSICVKdasGPYHYQ 269 Bacillus subtilis sub...
Q8Y8C6 203 IHENNlelpHTTHFLISNNEEIGYGGNSNIPAE--TVEYLAVDMGALg-DGQTSDEYT-------VSICAKdgsGPYHLG 272 Listeria monocytogenes
4X8I_B 263 LRQFADEVAKKYEIPLQVEpSPRPTGTDANVMQINREGVATAVLSIPIRYMHSqVELADARDVDNTIKL 331 Pyrococcus furiosus
P70801 271 LNGELRQCAKQLNMSVQLT-TLSGFGSDASIAMKFGHVGRAACLAFPTQNTHG-YEIAHLGAISNCINL 337 Nostoc sp. PCC 7120
Q92W97 275 LSKKLYELCGEHGIRVQKD-VFRYYRSDAASAVEAGHDVRTALVTFGVDASHG-YERIHLHALMSVAKL 341 Sinorhizobium meliloti
Q9HYE5 275 LSRHLLRLGERHDIALRRD-LFRYYHSDAQSAIAAGHDTRAALLAFGCDATHG-YERTHIDSLAALSRL 341 Pseudomonas aeruginosa
Q8R656 276 LRKKLQETASKNNIKYTVG-VYNRYGSDATTAVLQGFDFKYACIGPNVDATHH-YERCHNDGIIETVKL 342 Fusobacterium nucleatum subsp. n...
Q97L72 269 FRKRLVDICKNKNIPYRID-TYPYYGSDASAALKSGYDIKTALIGTGVYASHG-YERTHLDGMLATLDL 335 Clostridium acetobutylicum
Q8DQQ2 268 FRQHLVALAKEQDIPFKLD-IYPFYGSDASAAMSAGAEVKHALLGAGIESSHS-YERTHIDSVIATERM 334 Streptococcus pneumoniae R6
Q2FYS0 267 LKSHLVNLCKINNIPYKVD-IYPYYGSDASAALHAGADIRHGLFGAGIESSHA-MERTHIDSIKATEKL 333 Staphylococcus aureus subsp. aur...
O07603 270 LRKHLVQLAEKHHIDYKLD-IYPYYGSDASAAIKSGHDIVHGLIGPGIDASHA-FERTHKSSLRHTAKL 336 Bacillus subtilis subsp. subtili...
Q8Y8C6 273 LRKHLVELAKKNNIDYKVD-IYPFYASDASAAINAGNDIIHGLIGPGIDASHA-YERTHRDSLYHTEKL 339 Listeria monocytogenes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap