Conserved Protein Domain Family
SVA

?
pfam05326: SVA 
Seminal vesicle autoantigen (SVA)
This family consists of seminal vesicle autoantigen and prolactin-inducible (PIP) proteins. Seminal vesicle autoantigen (SVA) is specifically present in the seminal plasma of mice. This 19-kDa secretory glycoprotein suppresses the motility of spermatozoa by interacting with phospholipid. PIP, has several known functions. In saliva, this protein plays a role in host defense by binding to microorganisms such as Streptococcus. PIP is an aspartyl proteinase and it acts as a factor capable of suppressing T-cell apoptosis through its interaction with CD4.
Statistics
?
PSSM-Id: 398804
Aligned: 10 rows
Threshold Bit Score: 139.459
Threshold Setting Gi: 81894117
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O70417         1 MQGLSFTSTAATFFLVLCLQLGIN----EGQDNetIPQPLLFQLNVPSTp----DENQEVDMSLTLQTQYKECLVVKAYL 72  Norway rat
P60986         3 SLHLLLRASPAALLLILCLQLGTT----KAQEDttSRQLMTMDLQMLQI-----DTSEEATVVLEVSTDLRECMVVKAYL 73  cattle
XP_003270900   3 lLQLLFRASPATLLLVLCLQLGAN----KAQDN--TRKIIIKDFDIPKSv----RPNEEVTATLAVRTELKECMVVKTYL 72  northern white-...
P60990         3 ALQFLLRVSPAFLLLVLCLQLEIN----KAEES--IWKVIQMDLQMPTVa----VANEEVTVKLGIQTELKECMVIKAYL 72  rabbit
P02816         1 mQGLSFTFSAVTLFLVLCLQLGII----ESQDDenVRKPLLIEIDVPSTa----QENQEITVQVTVETQYRECMVIKAYL 72  house mouse
Q99N75         3 SLQMFYQPGALMHLLILCLFLETP----YGQEN--WNNPLSLDMIVSPM-----KGKNEFTVTLQVKNNVGQCMVVKVST 71  house mouse
Q9D2X6         3 SLQILSQPQAVTHFLILCLILEIA----SGQDN--RNNLLSLNLKVSSM-----NKANEFAVTLTVTNNVDKCMVVKISI 71  house mouse
NP_033325      3 SLQKFYQPGAVIYLLIVFLLQETAgfwyHGLHNepRNYTLTLNMKITPStsitnKKGNEFRVQLTVKNNVKQCQEVEINT 82  house mouse
Q76I99         3 SLQILQQTGGVM-LLILSLLLETA----YGQDN--RNKSLSLNRRLSQT-----NRTNEVIVELTVTNNVDKCLGIEIST 70  house mouse
P60987         3 TFQFLFRASPATLLLTLYLQLGVI----TAQED--TRRTIILSTELPQEv----TANELTTLKLKVETELRECMVIKAYL 72  domestic guinea...
O70417        73 ISNTPVD-GGFNYIQTRCICNDHPTTLYWTFVVTQTLTFRIMVDIVKDKGICPNN 126 Norway rat
P60986        74 LSNIPIE-GNFNYKFTSCLCNNYPRRFFWDLQTNSTVRITAVVDVIRELGICPDD 127 cattle
XP_003270900  73 ISSVPLE-GGFNYKYTACLCNNNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDN 126 northern white-cheeked gibbon
P60990        73 RSNIQID-GPFNYRYTSCLCDDYPRTFYWDLVANRTATIAAVVDIIRELDICPED 126 rabbit
P02816        73 VSNEPME-GAFNYVQTRCLCNDHPIRFFWDIIITRTVTFATVIDIVREKNICPND 126 house mouse
Q99N75        72 VMNPSIKyLSAHAIYTSCLCS--ANKYFWDIQVSDNTALQGKAEVVPAKSICPDD 124 house mouse
Q9D2X6        72 EDNPNIKyLSAKATYTACICT--VNNYFWDIQVFANTVLQGKAEVVSAKEICPDG 124 house mouse
NP_033325     83 EHERYIKfLSGPSTFETCICT--ISDFFWDIYVSESTYLTLSASILPYKNKCPDS 135 house mouse
Q76I99        71 EDNPNIKyLSTPEIPLACVCT--SAKFFWNVHVSENAVLQMKVEVFSEKDICNDD 123 house mouse
P60987        73 VSSKPLA-GPFNYKYTGCLCSDYPRTFYWDFQTNSTVRIATVVDIIRELNICPDD 126 domestic guinea pig
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap