Conserved Protein Domain Family
DUF730

?
pfam05325: DUF730 
Protein of unknown function (DUF730)
This family consists of several uncharacterized Arabidopsis thaliana proteins of unknown function.
Statistics
?
PSSM-Id: 114071
View PSSM: pfam05325
Aligned: 3 rows
Threshold Bit Score: 185.737
Threshold Setting Gi: 75157209
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O65229  20 MEIRMRTRYDKNRRRDKGVPIECDCNAKVVVATSLDPVTTGKLFFSCPHEISDGPGQGCGFKRWWTVALCDEFDMIKEET 99  thale cress
Q8LNP0  29 MEIRMRMRYGENRRRDKGVLIELDCNAKVVVATSHDPVTSEKLYFSCPYKISDGSGRGSGFKRWWTVALCDEFDMIKEEM 108 thale cress
Q9XH23  29 METRMRMVYGENRRRDKGVPIECGCSAAVVVATSRDPITSGKLYFSCPYEISDGPGRDCGFKRWCAVPLCDEFDKIKEEK 108 thale cress
O65229 100 TEMKKDLEAANkrvesqtekiflmekkfetlekkyesLNKYL 141 thale cress
Q8LNP0 109 IEMKKDLEAAN--------------------------ICELS 124 thale cress
Q9XH23 109 NEMKQDLVAAKkhvegqaekiflmekkfetlekkyesMNKYS 150 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap