Conserved Protein Domain Family
TraE

?
pfam05309: TraE 
TraE protein
This family consists of several bacterial sex pilus assembly and synthesis proteins (TraE). Conjugal transfer of plasmids from donor to recipient cells is a complex process in which a cell-to-cell contact plays a key role. Many genes encoded by self-transmissible plasmids are required for various processes of conjugation, including pilus formation, stabilisation of mating pairs, conjugative DNA metabolism, surface exclusion and regulation of transfer gene expression. The exact function of the TraE protein is unknown.
Statistics
?
PSSM-Id: 398799
Aligned: 32 rows
Threshold Bit Score: 144.727
Threshold Setting Gi: 123744184
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_013200010   1 MKLQVKETRNRVTVMALTAMTGLL-ALSVAGNCITGTLAWHFYSTQKTITTPMMFDRAFTSTAAEGDASLNSMLVRSFAN 79  Erwinia billingiae
jgi:Ajs_1540   1 MDFDRLRGDLKDMRRRNRGLGLAV-GALAAGLFLALAIIINLLGTVRTVVVPPSLSKTFWVTSDRASSEYLEQMGSFVAW 79  Acidovorax sp. ...
Q47DN0         1 MDFERLNGDIKEMRRRNRGLGLAV-GVLAAGQILALIVILNLLGTVRTVVVPPSIDKTFWVTRDKASNEYLEQMGSFIAW 79  Dechloromonas a...
CCB87838       1 MHVHFFTDKIKRLITIRNVLLLAL-LAMTCAFIRLSSLI--GKKEERVVIIPPAGK-PYWIEKSQVSEEYLQEIGLYLTT 76  Simkania negeve...
WP_012732836   6 AA-----ASRDALRSQIRFLKKLL-LVNGSSSVVIALVCAWLMMTQRVVIMPPAVRGTYVIGARYANDEYLADQAAYVLS 79  Burkholderia gl...
WP_013436699   5 KANNERDWLKSQVRFHRALNVGLL-AALLMGVILLGFVVLRDTTK----IVPPEVKRPYEISSNYANKDYLLDMADYVLA 79  Paraburkholderi...
WP_009242083   5 kainerDKLQSQVRFHRAMNAGLL-GTLFFGVLLLGFVVVRDTTK----IVPPEVKRPYEIGSNYANKDYLLDMAGYVLG 79  Betaproteobacteria
WP_012606789   1 mkfelfkKDYEGLLRNNRAFLIVI-GVLAVVVLMQQWAI--VTEKTRMVLVPPYIDKAVKIGYASADADYYESWGLYVSE 77  Acidithiobacill...
WP_011831728   1 MNLK---NMTKTWQAANKVAALMLvSNVALAAALLVSIVAFSGNRERVVLVPPHLEKRVSVGWNTADAEYLKGFGTYFAM 77  Methylibium pet...
WP_011733889   1 MKMTNYLSNASNLYGQNRLLKFVV-VVLGITTVVNTYMIRNAQQMEKVVIIPSVINDKMWLSGTKASDEYVKQFARDVSN 79  Pelobacter prop...
WP_013200010  80 LRLSVTPETVDAQHAALLRYVPPQDRSELKKSLAAEA-DYIK-KNGISTVFRID-DESTDTGTGDITVSGTLSAGTSNGS 156 Erwinia billingiae
jgi:Ajs_1540  80 LILDVTPSTIDWKKDILLGYVDPAQYGPLKTRQEVEA-ERLK-RINAATAFAPQ-QLVASEDTQSLVVRGRLRTLVNGME 156 Acidovorax sp. ...
Q47DN0        80 LVLDVTPASIDWKKEILLGYVEPEQYGPLKTRQEVEA-ERLK-RINAATVFAPQ-QLVPSEEGQSVVIRGRLRTVVNGFE 156 Dechloromonas a...
CCB87838      77 FLVDRTPLDVDFKNNMLLEHVHAEGYHCLKKVLREEA-DNIK-KNDHAFHFIKQ-RAFIDPEKLTYTVTGLQRVYIPRNK 153 Simkania negeve...
WP_012732836  80 LAKSVTPNTVDSNERILLSMVSDGRRAELKTQWDADA-LQLK-HDGVTSVAEPAgSAEVDLRSKSVKFPATISTYISGKL 157 Burkholderia gl...
WP_013436699  80 QVLTVTPDNVDYNVKTILRMAHPDGYGALKASLEAAA-LRMR-HERVTTIWVPR-KEEVNEQDLRVKVSGRLKTYIADKL 156 Paraburkholderi...
WP_009242083  80 TVLTVTPETVDYNNKVILKMADPDGYAGLKTALDAAA-MRLK-QERVTTIWVPR-KEEVSEQDKRVKVSGKLKTFIADKL 156 Betaproteobacteria
WP_012606789  78 LMGNLTPGDAPFVEKAMGKLFSSVSYEGVKSRIAQSAaEEAN--ADATFAFEAK-SVIWQSQTGTVFVHGTLRQVNGAGR 154 Acidithiobacill...
WP_011831728  78 LTANVTPKSASFVADTLSSAVSPAIYPEVRKQVLVLAkDPVFqKSGASVRFDPI-QVEYEAATNKVFVVGEITTNDATGR 156 Methylibium pet...
WP_011733889  80 MFLTYHPSNVRTNFNDLLAMYDPSEFAEAQRVLYNLA-ERIE-ESKAASGFYIT-KLVNNEEKHQLEITGSKTMIINGKV 156 Pelobacter prop...
WP_013200010 157 L-KLAIPdvtkAYRLSLHYV-DGLIRLTAFPE 186 Erwinia billingiae
jgi:Ajs_1540 157 T-ANDLK----AYRIEFGHA-AARMHVIGFKE 182 Acidovorax sp. JS42
Q47DN0       157 T-ANDLK----AYRVEFNYA-GARMHLKSFKE 182 Dechloromonas aromatica RCB
CCB87838     154 K-AAFLKeeevSYILSFKVE-DGRLFLKHIQK 183 Simkania negevensis Z
WP_012732836 158 T-STEQK----TFVVYFDISmFGRLTLLDIRE 184 Burkholderia glumae
WP_013436699 157 T-SERDK----DYLVEFNVTvSGRLYVSKIEE 183 Paraburkholderia rhizoxinica
WP_009242083 157 T-SEREK----DYLVEFTITtSGRLYVSKIEE 183 Betaproteobacteria
WP_012606789 155 TiSATPF----TFSMRVHIA-AGRPVLDDFhs 181 Acidithiobacillus ferrooxidans
WP_011831728 157 I-SRVQS----VYEMEIRMD-NGRPQVTamas 182 Methylibium petroleiphilum
WP_011733889 157 T-DNSIK----IYLLDYKIE-SGKFCILRFME 182 Pelobacter propionicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap