Conserved Protein Domain Family
DUF737

?
pfam05300: DUF737 
Protein of unknown function (DUF737)
This family consists of several uncharacterized mammalian proteins of unknown function.
Statistics
?
PSSM-Id: 398793
Aligned: 32 rows
Threshold Bit Score: 108.117
Threshold Setting Gi: 432861259
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_004069579  18 VTFVKGIRLSDNVINRMKLSPKGSTplilsepqtsattpgpaspvqslspplpqeasppsqplltklapppvkfhslpps 97  Japanese medaka
Q5FVV3        21 VRVLRGVRLSDEVVNRMKDSDLPSKdqstsaasgtasapaafps------------------------------------ 64  tropical clawed...
Q9BRQ6        22 VRVLQGVRLSENVVNRMKEPSspppaptsstfglqdgnlr---------------------------------------- 61  human
Q91VN4        22 VRVLQGIRLSESVVNRMKDCSQPSAgeqlvpgfgpsssapvptvplpaisvptvpapttpv------------------- 82  house mouse
EHB03687      22 VRVLQGIRLSENVVQRMKDPSPLAEgqqpapppaapdcgsta-------------------------------------- 63  naked mole-rat
XP_006929100  22 VRVLQGIRLSENVVNRMKDPNQPCKagepapppapppstggssk------------------------------------ 65  domestic cat
Q32L35        22 VRVLQGIRLSENVVNRMKEPGQPSRvgllappaaalgpsggr-------------------------------------- 63  cattle
XP_016156984  23 IRVLQGIRLTEDVVNRMRGCSVRKRdihpsprasdgt------------------------------------------- 59  Collared flycat...
XP_016846320 160 VRVLQGIRLSEDVVNRMKQPCQTKKdqrappippspilqpaegk------------------------------------ 203 green anole
XP_001377393  21 VRVLQGIRLSEDVVNRMKDSSASSRvqqpspasppptststsppaaspahasspppsls--------------------- 79  gray short-tail...
XP_004069579  98 svepvestspaeaqtcpfvssaqsktpavpeypvsvvesvtpthskleaqtpapvleqtaellnrspgeetppafepssq 177 Japanese medaka
Q5FVV3           --------------------------------------------------------------------------------     tropical clawed...
Q9BRQ6           --------------------------------------------------------------------------------     human
Q91VN4           --------------------------------------------------------------------------------     house mouse
EHB03687         --------------------------------------------------------------------------------     naked mole-rat
XP_006929100     --------------------------------------------------------------------------------     domestic cat
Q32L35           --------------------------------------------------------------------------------     cattle
XP_016156984     --------------------------------------------------------------------------------     Collared flycat...
XP_016846320     --------------------------------------------------------------------------------     green anole
XP_001377393     --------------------------------------------------------------------------------     gray short-tail...
XP_004069579 178 tpavtiqpaaaaeplesaapspaepaslsptlesaqvesllpsapseaaettpcaappavvtdvpsvleppagpasqppa 257 Japanese medaka
Q5FVV3           --------------------------------------------------------------------------------     tropical clawed...
Q9BRQ6           --------------------------------------------------------------------------------     human
Q91VN4           --------------------------------------------------------------------------------     house mouse
EHB03687         --------------------------------------------------------------------------------     naked mole-rat
XP_006929100     --------------------------------------------------------------------------------     domestic cat
Q32L35           --------------------------------------------------------------------------------     cattle
XP_016156984     --------------------------------------------------------------------------------     Collared flycat...
XP_016846320     --------------------------------------------------------------------------------     green anole
XP_001377393     --------------------------------------------------------------------------------     gray short-tail...
XP_004069579 258 sleetsppchdepsavpteesfgkftasplpdptlpaggstmstsgppqdedeepfcpvspptaalpispeEVE----ED 333 Japanese medaka
Q5FVV3        65 ----------------------------------------------------kagpsashpaststggahkPTAa---GV 89  tropical clawed...
Q9BRQ6        62 -----------------------------------------------------aphkestlprsgssggqqPSG------ 82  human
Q91VN4        83 ------------------------------------ptapsssvrglpggtckgpltdvkvpsaesggglqSSA------ 120 house mouse
EHB03687      64 ------------------------------------------------------pqkepklptskigggrqPSG------ 83  naked mole-rat
XP_006929100  66 -----------------------------------------------------gpekdskpprseygggrqPSG------ 86  domestic cat
Q32L35        64 -------------------------------------------------------ekdskpprpdcgsgrgPPR------ 82  cattle
XP_016156984  60 -----------------------------------------------------------apsslaagvkpkPTGiqppKA 80  Collared flycat...
XP_016846320 204 -----------------------------------------------------skvptgispptpdslgrkPSE------ 224 green anole
XP_001377393  80 --------------------------------------hassfafgssegkskrprtdpkppkaesqssrqPSE------ 115 gray short-tail...
XP_004069579 334 LRRRIKAEMekdlqqemnqrrqelerqlEEMRARaeaeakaasrarVEEQVKKTLEEEKAAYVEKLTESIAKERIKSEDE 413 Japanese medaka
Q5FVV3        90 GQQYAEEDLyr---------------ryEREQAI------------IQEELARLAKRERESAHEKLSASILLEKNSTNQE 142 tropical clawed...
Q9BRQ6        83 ----MKEGvk----------------ryEQEHAA------------IQDKLFQVAKREREAATKHSKASLPTGEGSISHE 130 human
Q91VN4       121 ----VKEDlk----------------kfQQEQLA------------VQDEMVRVAKKEKEAAEKHLKASLPKKKASLTHE 168 house mouse
EHB03687      84 ----VKEDlk----------------rfRQEQAT------------VQDELFRVVRREREAAAKHVTAVPPAVEGSTDQE 131 naked mole-rat
XP_006929100  87 ----VEEDFlk---------------ryKQEQAK------------VQDELFQVVTREREAATKHRSASMQRGEGSVDQD 135 domestic cat
Q32L35        83 ----VQVDPle---------------rcDWEQAV------------LQDELVRVATTEREAAASPRSVTLRRGEGGVDQE 131 cattle
XP_016156984  81 GDSAAEHELyr---------------ryVEEQAL------------VQEELLWLAKKEREAACE------AKQRNSIIEE 127 Collared flycat...
XP_016846320 225 ----AEEELyk---------------ryEQEQAM------------VQEELLRLAKREREAATESLNVTLQRERSNTNEE 273 green anole
XP_001377393 116 ----AEEDLyr---------------ryDQEQAM------------VQEELLQLAKREREVAREHLKSSLPREKSGTNQE 164 gray short-tail...
XP_004069579 414 KLAAQLYwme--------------lkARQLEEKEEELKKREELRKKQVAKLEAKCAQFYRVSAESFQKGKEETESRF 476 Japanese medaka
Q5FVV3       143 RRKAEHL-------------------AKELEQKEAELQRLNTFYREQLSSIEKKNLEIYRLTAEQYHTAATNAELRV 200 tropical clawed frog
Q9BRQ6       131 EQKSVRL-------------------ARELESREAELRRRDTFYKEQLERIERKNAEMYKLSSEQFHEAASKMESTI 188 human
Q91VN4       169 QQQSARL-------------------ARELEDREAELSRRDTFYKEQQGRIQEKNAELYKLSSQQFHEAASKAESTI 226 house mouse
EHB03687     132 KQQSARL-------------------ARELESREAELRHHDTFYQEQLGCIERKNVEMYKLSSQQFHEAASKAENTI 189 naked mole-rat
XP_006929100 136 KRKSTQL-------------------ARELESREAELSRRDTFYKEQLGRLERKNAEMYKLSSQQFHEAASKMEGTI 193 domestic cat
Q32L35       132 KQRLAQR-------------------ARELESQEEELRCRDAFYKEQLGRLERQNLEAYRLSSQQFHEAATKIEGAI 189 cattle
XP_016156984 128 RQKTAQVslssplpdsekmpvdldawAMQLQVREAELKLQEDFYKEQLARIEKKNAEIYKMTTEQYQEAATKAEERI 204 Collared flycatcher
XP_016846320 274 KQKTSQIpadl------------dawSKELQWKDEELKRRDTFYKDQLAHIEKKNSEIYKMTLSQFSDAVTNAEDRI 338 green anole
XP_001377393 165 KQRSAQL-------------------AKELEGVEAELRRRDIFYREQLGRIERKNAEMYKLSSQQFHEAATRLEETI 222 gray short-tailed ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap