Conserved Protein Domain Family
ASFV_L11L

?
pfam05293: ASFV_L11L 
African swine fever virus (ASFV) L11L protein
L11L is an integral membrane protein of the African swine fever virus (ASFV) which is expressed late in the virus replication cycle. The protein is thought to be non-essential for growth in vitro and for virus virulence in domestic swine.
Statistics
?
PSSM-Id: 114041
View PSSM: pfam05293
Aligned: 2 rows
Threshold Bit Score: 113.473
Threshold Setting Gi: 82000874
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q65266  1 MLEPLLVMAPIPLILIFLYSYFKIKLHKLITIALFLGCLFFILRDFCFPPMLWQILNNTTSTLNTFLGNNSFYVNCKK 78  African swine fever virus
O93198 17 MLEPILVMAPIPLVLIFLYSYFKIKLHKLITIALFLGCLFFILRDFCFPPMLWTQLQNITLPFNNILGNKSFQVKCNN 94  African swine fever virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap