Conserved Protein Domain Family
SH3BP5

?
pfam05276: SH3BP5 
SH3 domain-binding protein 5 (SH3BP5)
This family consists of several eukaryotic SH3 domain-binding protein 5 or c-Jun N-terminal kinase (JNK)-interacting proteins (SH3BP5 or Sab). Sab binds to and serves as a substrate for JNK in vitro, and has been found to interact with the Src homology 3 (SH3) domain of Bruton's tyrosine kinase (Btk). Inspection of the sequence of Sab reveals the presence of two putative mitogen-activated protein kinase interaction motifs (KIMs) similar to that found in the JNK docking domain of the c-Jun transcription factor, and four potential serine-proline JNK phosphorylation sites in the C-terminal half of the molecule.
Statistics
?
PSSM-Id: 398785
Aligned: 22 rows
Threshold Bit Score: 237.168
Threshold Setting Gi: 226524606
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:MICPUN_62998 237 EEVDPRVAGALDEMNEAMMSVNDAETALAAAKRRRRAHKAEGSQKIEETRKKLS-SSVRAAVPFFHAQAVAHMYQVRSIE 315 Micromonas ...
Q21194            33 TRHLNMIHEELEKLNISTDVINKMEVQLDLARADFRETQVQWSEKLKELSKQYS-SQIAKARPFYELKIKERSLREESQK 111 Caenorhabdi...
2_pfamImport       1 ---MMSIRRQLENLNDATDDINSYEMKLEHVKKQFCETQLIFNREISGIPNKLA-KHISKARPFFDLKSREPNLRRFAQQ 76 
XP_004365456     284 EIADPRIKGALEALNFATEEINRLERELEASKRTLRVLDRDGAKQLLALAQKLG-KAVDRSRAYYNLKHEASEAHRLAIE 362 Capsaspora ...
XP_001746898     283 EEVDPRVEIALQDMNDASDAINRLEKELEETKAAFKTAMDQVQIDLRDLANKLGrRNIDKARPYHQALFRARKAHYESRQ 362 Monosiga br...
CAF99475          18 EEVDPRIQGELEKLNQSTDDINRWESELEDGRQRFRAVLVEAMCKLDGLMKRIG-RAVDDSKPYWEARKVAKQAQIEAQK 96  spotted gre...
XP_015789483      18 SNLDPRIGLKLEELNKWTGRINTLEKSFEEANSKFRITLNESTDRLKLLSTKLG-KSIDDSRPYYEAKDRLTEVQAKCQK 96  two-spotted...
XP_001603858       9 gPLDPRIQIELENLNNATDDINKLEIELDEANTVYGQLLSETTSRLKELMNKLGsNCIDKAKCYFEACEVAHQARLKCQQ 88  jewel wasp
XP_008198596       7 NELDPRIQIELEKLNTTTDEINRLEIEYDEANTTFRMLLNESTRRLKILSKKLG-SCIERARPYYEALEIAKKAQQECQK 85  red flour b...
XP_001952650      30 DSLDPRIQLELEKLNSSTDNINKLEIELDEANTTFRMLMAEASRRLKVRARKLG-SCIDKARPFYDALNMSKHSQQQCQI 108 pea aphid
jgi:MICPUN_62998 316 CLRAYEKAHDMHAAAKESAAQLEAEMAssaspgkkitgnEGGTFDTDLMIALSDAMSKVVETEIMKKRAEGAHGRMTKLA 395 Micromonas ...
Q21194           112 AAERFERATSILGIAKQQVSLTQESLS------------RQTSVLPECLEVLNHHIQRVREVEEERTAAESLHASKAHAM 179 Caenorhabdi...
2_pfamImport      77 AAALFERQKTVVEMAREQLTILHSSLNn----------nDEMDAEKKYIDVIEQQLELVNEAEAECAEAERAHAARVRDL 146
XP_004365456     363 AAKTFEKACSAHDAAKERLAKAERHVLt-----------DNKKIDPVWHDMMATAATQVIESENAKRDASTTHQALLSAA 431 Capsaspora ...
XP_001746898     363 AAVYFEKASGAYQQAKQKVKATEQQLE------------KGATFDANLQASLNKATQDLMTAFNRKEHADTIHQTKTQTF 430 Monosiga br...
CAF99475          97 ATQEFQRSVEILRAAKETIALAEERLLe----------eDSRQFDSAWQEMLNHATQRVMEAEQSRTRSEAEHKKTAANY 166 spotted gre...
XP_015789483      97 AAINFEKACQAYLEAKERINLAEKKFNs-----------AAHEFDTTWQEMLNQANIKLMEAETMKKESERLHHNSMKDF 165 two-spotted...
XP_001603858      89 QAQLYQRANVVHAAAKETVALAEERFMsh---------qHEWNFDQAWQDMLNHATLKVMEAESQKAECAREHHKRTVLF 159 jewel wasp
XP_008198596      86 AAVQFQRANEIHAAAKETVALAEQRFLsn---------qHEWQFDNAWQEMLNHATIKVMEAENQKAESGREHQRRATIF 156 red flour b...
XP_001952650     109 AAVKYQRANEIHQAAKETVALAEARFLsk---------qHEWKFDSAWQEMLNNAIQKVTEAENQKTESGREHQRKAALY 179 pea aphid
jgi:MICPUN_62998 396 TTAVNESMALRKKIAKSVEKAQPYFAVKSSVEAKARALEEEVVDVEKRVKEMKRRYHAAMDELAKISDEVHARRLREKEE 475 Micromonas ...
Q21194           180 LHLAEKIRAMEKDNRYAIKKSRLYFEKRLEFTKILEAQKATILCLEAEVRQKKNDYTTSLRNLERISERIHEERSTGSLE 259 Caenorhabdi...
2_pfamImport     147 LQLETTLRRLLQENGPSIKKARPYYDRKEVLTKTMNSQIELMSILENEVQDRKDSYSTSMRALEQISEQIHQERSSQNSL 226
XP_004365456     432 AHVSTKLEAAARDIKPRIAKAKPYYDLQNELREQRTKLVDKQTFLAEEIALAKRHVQYSLSNLNDISMEIHEQRRARKAE 511 Capsaspora ...
XP_001746898     431 LKADRELMELAKARKKIIIKTKPYYESKVQHDKILMGLRQQLLQQERDIKAAKEKYSNSLNTLSSISEEIHERREAEKAA 510 Monosiga br...
CAF99475         167 NSSISHMRQLEKKLKRSINKSRPYFELKGKYYLQLEHLKILVNERQAKLMSAKAEYRKALRNLESISEEIHAQRRSVAMG 246 spotted gre...
XP_015789483     166 HSAEMVVVDLKKKLKGSLHRSKRYFEEKKRFQKQLGSIKEEIESIISQINCSKARYAATLRELEAISEEIHEKRNCSLLK 245 two-spotted...
XP_001603858     160 HEAEKKVQQLEEKYRRSINKAQPYFELKAQCDQKLAIQKEVVDCLKKAVKDAKCSYAASLRALEEISNQIHKRRRDYDIV 239 jewel wasp
XP_008198596     157 KTAEDCVKQLESRLQKSIIKSRPYFDEKSLCQQQLNTQKDRIETIKRDIVKTKSSYAQTLKQLEQISNEIHMKRGSVTED 236 red flour b...
XP_001952650     180 QAAEQKVQMLEQKFKRSIIKSRPYFEEKYLCEGQLAAQKDTIIQIRYAVQRAKQEYSACLHRLEQISEEIHVQRQNNKLM 259 pea aphid
jgi:MICPUN_62998 476 RE 477 Micromonas commoda
Q21194           260 SA 261 Caenorhabditis elegans
2_pfamImport         --    
XP_004365456     512 as 513 Capsaspora owczarzaki ATCC 30864
XP_001746898     511 kt 512 Monosiga brevicollis MX1
CAF99475         247 TR 248 spotted green pufferfish
XP_015789483     246 HL 247 two-spotted spider mite
XP_001603858     240 AN 241 jewel wasp
XP_008198596     237 IL 238 red flour beetle
XP_001952650     260 EC 261 pea aphid
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap