Conserved Protein Domain Family
DUF725

?
pfam05267: DUF725 
Protein of unknown function (DUF725)
This family contains several Drosophila proteins of unknown function.
Statistics
?
PSSM-Id: 398779
Aligned: 61 rows
Threshold Bit Score: 75.0717
Threshold Setting Gi: 0
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9VAK2               53 QCFSIYKPKLAKIADQFETNFTACISAYDNCTSHISEKYAEDRQILLRSANIGCSYPnSNCqvwtleqQ--PLDTVVSRL 130 fruit fly
WGS:AAPU:GI20244-PA  54 TCFSRYTNATSKIGSDLSSKTTKCEDVAKRTVVENLQRSNATVNTIRSQQIELQKNL-QRC-------L--NETDSQRFI 123 Drosophi...
XP_002005035         55 TCFDEYLYNQQNAMFNYNKFYTGCVNTAESEKNDLTAESAAIRQDLLSRSDNMCGVL-SSC-------D--KYVDGLEFF 124 Drosophi...
XP_002050443         55 NCFNQYITDQMNVLDNYNRIYTGCVTTAQREKTELTAQSAESRKDLLSRSDGMCTNL-GSC-------D--LLTDGLEFF 124 Drosophi...
XP_001986576         56 NCFNQYIIDQTATLTNYNKVYTACVATAQTDKNTLTAQSEESRNDLLSRSEDMCSSM-NSC-------E--SFADGLQFF 125 Drosophi...
XP_001960119         54 DCFNNYMVEQTNVIMGYNKQYTGCISAADQSRSDLTEQSAAERSDLLDRTNKMCSDL-SVC-------E--AQSDGLDFF 123 Drosophi...
EDX07603             55 DCFNHYMEDQTNVIMSYNLQYTGCLRTAQTGRDELTKESASEREALLDRTNKMCSSL-TQC-------D--TLVDGLDFF 124 Drosophi...
EDW32231             56 DCFNHYLDDQREVIVNYNLHYNGCINTAQASREALTAESASERQSLLDRTNAMCTSL-TSC-------D--AEVDGLKFF 125 Drosophi...
1_pfamImport          2 VCFQESNAALLEVSNKAETAIIKCERILTEAQVQADNELESNRKSLDEDNKNIQSDL-SSC-------DssNLEDATDAL 73 
Q7QGG6              105 PCFESVPQNIRDIVQGARAEAGQCGKQTLDRVRKIQENIEQHIQDGAEKVKQIVAIG-QKClqenswiG--------DQI 175 Anophele...
Q9VAK2              131 ECASTNSAESSKTFYAISANATQIAVQIQEQYTILESRKSVCINDA 176 fruit fly
WGS:AAPU:GI20244-PA 124 NCTVSTLDRNLELLDSCNTLAYQTQSQFVSNASVVETQRSSCIRAA 169 Drosophila mojavensis
XP_002005035        125 DCYRNASTDSYKIMFTLNSDANIQFNTISAKYDIINFDLKTCVDTA 170 Drosophila mojavensis
XP_002050443        125 DCYRNASADSYKVMFTLNSDANTRFNTISTKYGIIDSDLTQCVDEA 170 Drosophila virilis
XP_001986576        126 DCYRTSSADSYKVMFTLNSDANTQYNTISNKYNIIDSDLTICVEDA 171 Drosophila grimshawi
XP_001960119        124 DCYRDASTNSYKTMFTLNSDSNLDYNRINAAYAQVDSVLNACVDEA 169 Drosophila ananassae
EDX07603            125 DCYRNASSDSYKVMFTLNSDSSLDFNRISAKYQVIETDLTDCVDSA 170 Drosophila simulans
EDW32231            126 DCYRLASSDSYKTMFTLNSDSNLDFNRISASYSVIETDLTDCVDVA 171 Drosophila persimilis
1_pfamImport         74 KCYEAQGQQNISPVSGLSSKARTFKRTYDITISLAKTKSDGCSHD- 118
Q7QGG6              176 NCALQNAPVAVSIVEDIVKDAAGLIGHTSREVSALAKDTEQCLAva 221 Anopheles gambiae str. PEST
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap