Conserved Protein Domain Family
UPF0220

?
pfam05255: UPF0220 
Uncharacterized protein family (UPF0220)
This family of proteins is functionally uncharacterized.
Statistics
?
PSSM-Id: 398773
Aligned: 68 rows
Threshold Bit Score: 118.461
Threshold Setting Gi: 470304260
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EDP42471      12 RIrlPkIPLNMQANRHAMGVCLAGALFAGGWWLFFDACIRSGRLnmstpaplpspvpqprpgepipqpkhgVFIKFDDWV 91  Malassezia glob...
1_pfamImport   6 RWpeCeC-IDWSERRNAVASVVAGILVSEKDWLVTFIPYLLPWK---------------------------LMPNYLFH- 56 
Q17C83         8 R---QsYWVENVPRRNIVATLVASFLFFSGWWIAIDTAAVHPKS-----------------------------WDFSYYI 55  yellow fever mo...
PDM84476       9 S---CnCNIDWDGKRNGVASIVAATLFFSAWWLMLDTAAVYDKK----------------------------DWTNVYII 57  Pristionchus pa...
PDM66403       9 A---CsCNVDWDGRRNGIASVVAGALFFSAWWIVLDTAMVVDKK----------------------------DWNNLYFI 57  Pristionchus pa...
EGT35428       9 R---CdCSFDLEGRRNAVASIASAALFFIAWWLMIDTAAVYEKK----------------------------DWTNVYFI 57  Caenorhabditis ...
CDQ01721       9 N---YnCDIDWDSKRNAVASCISSAMFFIGWWLLIDTAAIYTPV---------------------------GQWNNVYII 58  Brugia malayi
XP_011068317   9 QVpsCvW-FEGGEKRNALISMLAGTLFFVGWWFIIDAHAKYPDE-----------------------------MSNAYHV 58  Panamanian leaf...
XP_015781391   9 QIntPeW-LNLSEKRNAVASIIAGVLFFTGWWIIIDVNSLFGSE----------------------------DFSLGYHV 59  two-spotted spi...
XP_015782119   9 RInmPeWMDNLGEKRNAIASIAAGFLFFTGWWIIIDVNACFSSE----------------------------DFNSAYHV 60  two-spotted spi...
EDP42471      92 PGLCATIGLSIVNLVDKRHLMDeDG------TGqiGawqddpvmwrTRTWLFIGFAFLAGGIAGSLAILIIKYMMnPDAV 165 Malassezia glob...
1_pfamImport  57 CFLLMILYCSRINAVSNAQVRG-DSyes-gcLGrtG----------ARVWLFIGFMLMFGSLIASMWILFGAYVTqNTD- 123
Q17C83        56 CGILATISFFMVNSISNEMLHG-GAgytggvLGesG----------IKVFLFVGFVLGFASIIAAIWIMIAEFAVnDDKT 124 yellow fever mo...
PDM84476      58 VTVASSIAMFMVNAISNSQVRG-EAlqe-svLGtkG----------ARLWLMGAFCLSFACLVAATWLLFSDYVLvPGDH 125 Pristionchus pa...
PDM66403      58 LTISSSVGMVLLNSVSNSQVRG-DSmne-svLGvtG----------ARLWMLLSFGISFACVFAAVGLLFKGYIK-PGDH 124 Pristionchus pa...
EGT35428      58 ITISSTIAMFMVNAISNSQVRG-ESlhe-glLGtkG----------ARLWLMAAFVVSFASLVAATWILFSDYVLrQGEH 125 Caenorhabditis ...
CDQ01721      59 VTVCGTIAMFMVNAVSNSQVRG-ESmne-niLGtkG----------SRLWLMLGFVLSFASLVAALWIMFADYVLvTGDH 126 Brugia malayi
XP_011068317  59 CGVFGTISLFMVNSVTNAQIRG-EAyng-gcLGarG----------ARSWLFIGFVMGFAAVIAACWILFANFVAaGAPH 126 Panamanian leaf...
XP_015781391  60 CGIFATVSLFMINAVSNGQVRG-ESynt-gfLGqkA----------ARTWLFVGFVLGFSSIIAATWILFAAYVIpNKQV 127 two-spotted spi...
XP_015782119  61 CGIFATISLFMINAVSNSQIRG-ESygt-gfLGqrA----------ARVWLFIGFVLGFSSIIAATWILFAVYVIpDKKV 128 two-spotted spi...
EDP42471     166 GfVEFGVAGVLQNLAIMACAMVLWFSQHVESDY 198 Malassezia globosa CBS 7966
1_pfamImport 124 --VYPGLAVFFQNALIFFSTLIYKFGR-TEELW 153
Q17C83       125 E-KGPGYALLVHNIFIFFSSIIYKFGRHSDDPY 156 yellow fever mosquito
PDM84476     126 P-VWPGVALFIHNLMIFAASLVYKFGR-TEDLW 156 Pristionchus pacificus
PDM66403     125 V-VWPGVTLLIHNLMIFAASLVYKFGR-VEDLW 155 Pristionchus pacificus
EGT35428     126 T-VWPGVALFLTNFIIFASSCVYKFGR-TEEMW 156 Caenorhabditis brenneri
CDQ01721     127 P-IWPGVALFLHNFLIFISSLVYKFGR-TEELW 157 Brugia malayi
XP_011068317 127 --HWPGVGLFLQNIFIFLGSLTYKFGR-SEDQW 156 Panamanian leafcutter ant
XP_015781391 128 --IYPGIGLFLQNILIFAGSLVFKFGR-SEDDm 157 two-spotted spider mite
XP_015782119 129 --LHPGVGLFLQNVLIFSGSLVFKFGR-VEDyl 158 two-spotted spider mite
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap