1V8B,3G1U


Conserved Protein Domain Family
AdoHcyase

?
pfam05221: AdoHcyase 
Click on image for an interactive view with Cn3D
S-adenosyl-L-homocysteine hydrolase
Statistics
?
PSSM-Id: 398750
Aligned: 150 rows
Threshold Bit Score: 730.806
Threshold Setting Gi: 31340526
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1V8B_C               5 KSKVKDISLAPFGKMQMEISENEMPGLMRIREEYGKDQPLKNAKITGCLHMTVECALLIETLQKLGAQIRWCSCNIYSTA 84  Plasmodiu...
A4XPF3              12 DYKVADISLADWGRKELIIAESEMPALMGLRRKYAASQPLKGAKILGCIHMTIQTGVLIETLTALGAEVRWSSCNIFSTQ 91  Pseudomon...
A4VRF7              12 DFKVADISLAAWGRREIIIAESEMPALMGLRRKYAAEQPLKGAKILGCIHMTIQTAVLIETLIALGAEVRWSSCNIFSTQ 91  Pseudomon...
zhongguo:B5T_00252  10 DYKVADISLAQWGRSEIEIAETEMPALMAIRAKYRAEQPLKGARIIGCIHMTIQTAVLIETLKELGAEVRWSSCNIFSTQ 89  Alcanivor...
XP_002111388        31 DFCVKNIKSAEFGRREIEIAEQEMPGIMILRVKYAENKPLQSARIIGCTHITAQTAVLIETLITAGASVRWAACNIYSTQ 110 Trichopla...
XP_001625738        53 DFCVKNIKLADFGRREIEIAEQEMPGLMLLRKRNCTDKPLEGAKIVACTHVTAQAAVLIETLMALGAQIRWCACNIYSTQ 132 starlet s...
NP_001074118        71 DFCIKNIKLADFGRRQIELAEDEMTALMALRKAAQGEKPLAGAKIVGCTHVTAQTAVLFETLSGLGAQCRWAACNIYSTQ 150 zebrafish
P50245              67 DFCVKSISKSAFGRREIEIAESEMPGIMTLRKRAKDEKPLKGANIVGCTHVNAQSAVLIETLVQLGATVRWAACNIYSTQ 146 fruit fly
XP_029698134       100 DFCIKSIKQAHFGRREIEIAEQEMAALMFLRKRVGGEKPLAGAKVMGCTHITAQTAVLIETLSVLGAQCRWAACNIFSTQ 179 torafugu
XP_019217049       142 DFCIKNISQADFGRKEIEMAGREMPALMNLRKRAGGEKPLAGAKVVGCTHITAQTAVLIETLVALGAQCRWAACNIFSTQ 221 Nile tilapia
1V8B_C              85 DYAAAAVSTLeNVTVFAWKNETLEEYWWCVESALT------WgdgddnGPDMIVDDGGDATLLVHKgveyeklyeeknil 158 Plasmodiu...
A4XPF3              92 DQAAAAIAAA-GIPVFAWKGETEEEYEWCIEQTILkdg-kpW------DANMVLDDGGDLTEILHK-------------- 149 Pseudomon...
A4VRF7              92 DQAAAAIAAA-GIPVFAWKGETEEEYEWCIEQTILkdg-qpW------DANMVLDDGGDLTQILHD-------------- 149 Pseudomon...
zhongguo:B5T_00252  90 DHAAAAIAAS-GVPVFAWKGETEEEYMWCIEQTCRdgdgnlW------DANMILDDGGDLTAYIHD-------------- 148 Alcanivor...
XP_002111388       111 NEVAAALAEE-GIPVFGWKGMSEDDFWWCIEKASNhq---nW------QANLILDNGGDATHYMKR-------------- 166 Trichopla...
XP_001625738       133 NEVAAAMAES-GLSIFAWKGESEEDFWWCIEKCITsn---gW------QPNMVLDDGGDATHLMYK-------------- 188 starlet s...
NP_001074118       151 NEVAAALAER-DFPVFAWKGESEDDFWWCIDRCVNve---gW------EPNMILDDGGDMTHWIYK-------------- 206 zebrafish
P50245             147 NAVAAALAEA-GIPIFAWRGETEEEFWWCLDRAIYsd---gW------QPNLILDDGGDATHLMLK-------------- 202 fruit fly
XP_029698134       180 NAVAAALAEQ-GTAVFAWRGESEDDFWWCIEKCVGae---sW------QPNMILDDGGDLTHWIYK-------------- 235 torafugu
XP_019217049       222 NAVAAALVKA-GISVFAWRGESEDEFWWCIDHCVGte---tW------QPNMILDDGGDLTDWIYK-------------- 277 Nile tilapia
1V8B_C             159 pdpekakneeercfltllknsilknpkKWTNIAKKIIGVSEETTTGVLRLKKMDKQNELLFTAINVNDAVTKQKYDNVYG 238 Plasmodiu...
A4XPF3             150 ---------------------------KYPQMLERIHGITEETTTGVHRLLDMLKAGTLKVPAINVNDAVTKSKNDNKYG 202 Pseudomon...
A4VRF7             150 ---------------------------KYPQVLERVHGITEETTTGVHRLLDMLKGGTLKVPAINVNDSVTKSKNDNKYG 202 Pseudomon...
zhongguo:B5T_00252 149 ---------------------------TYPEMLDNIHGITEETTTGVHRLYDMLKKGTLKVPAVNVNDSVTKSKNDNKYG 201 Alcanivor...
XP_002111388       167 ---------------------------KYIDKFRCLKGIVEESVTGVHRLYQMTKNNCLPIPAMNINDSVVKGKFDNLYC 219 Trichopla...
XP_001625738       189 ---------------------------KFNGTFNTLKGIVEESVTGVHRLYQLSKQGKLTVPAMNVNDSVTKTKFDNLYC 241 starlet s...
NP_001074118       207 ---------------------------KYPHIFKKVKGIVEESITGIHRLHHLSKAGKLCVPAINVNDSVTKQKFDNLYC 259 zebrafish
P50245             203 ---------------------------KYPDYFKAIRGIVEESVTGVHRLYMLSKGGKLTVPAINVNDSVTKNKFDTFYT 255 fruit fly
XP_029698134       236 ---------------------------KHPGLFRNLKGIVEESVTGIHRLYQLSKAGKLCVPAINMNDSVTKQKFDNLYC 288 torafugu
XP_019217049       278 ---------------------------KYPELFKNLKGVVEESITGVYRLYQLSKAGRLSVPAMNVNDSVTKQKFDNLYF 330 Nile tilapia
1V8B_C             239 CRHSLPDGLMRATDFLISGKIVVICGYGDVGKGCASSMKGLGARVYITEIDPICAIQAVMEGFNVVTLDEIVDKGDF--- 315 Plasmodiu...
A4XPF3             203 CRHSLNDAIKRGTDHLLSGKQALVIGYGDVGKGSAQSLRQEGMIVKVSEIDPICAMQACMDGFELVSPYKNGINDGTess 282 Pseudomon...
A4VRF7             203 CRHSLNDAIKRATDHLLSGKQALVIGYGDVGKGSAQSLRQEGMIVKVSEVDPICAMQACMDGFELVSPYKNGINDGTeas 282 Pseudomon...
zhongguo:B5T_00252 202 CRHSLNDAIKRGTDHLLSGKKALVVGYGDVGKGSAQSLRQEGMIVKVTEVDPICAMQACMDGFEVVSAFKNGVNDGTaas 281 Alcanivor...
XP_002111388       220 CREAVIDSLKKTTDIMFGGKQVLICGYGEVGKGCCSALRGMGAIAYVTEIDPICALQACMDGFKVIRVDDAIRIVD---- 295 Trichopla...
XP_001625738       242 CRESILDSLKRTTDVMFGGKQVLVCGYGEVGKGCCAALKGLGAIVYITEIDPICGLQACMDGFRVVKIEEVCKHID---- 317 starlet s...
NP_001074118       260 CRESILDSLKKTADIMFGGKQVVVCGYGEVGKGCSAALKAMGSIVYVTEIDPICALQACMDGFRLTKLSDVVRQVD---- 335 zebrafish
P50245             256 CRDSILDSLKRTTDIMFGGKQVVICGYGDVGKGCAQSLKGQGCIVYVTEVDPICALQAAMDGFRVVRLNEVIRTVD---- 331 fruit fly
XP_029698134       289 CKESVLDGLKRSTDVMFGGKQVLVCGYGEVGKGCCAALKAVGAVVYVTEVDPICALQACMDGFRVVKMKEVVRRVD---- 364 torafugu
XP_019217049       331 CKESVLEGLKRTTDIMFGGKQVVVCGYGEVGKGCCAALKALGAIVYVTEVDPICALQACMDGFRVIKLSEIVRHID---- 406 Nile tilapia
1V8B_C             316 -----------------FITCTGNVDVIKLEHLLKMKNNAVVGNIGHFDDEIQVNELFNYKGIHIENVKPQVDRITLPNG 378 Plasmodiu...
A4XPF3             283 vdaallgkidlivtttgNVNVCDAGMLKALKKRAVVCNIGHFDNEIDTAFMRKNWAWEEVKPQVHKIHRTGAGQFDPTND 362 Pseudomon...
A4VRF7             283 vdaallg-kidlivtttGNVNVCDAGMLKALKKRAVVCNIGHFDNEIDTAFMRQNWGWEEVKPQVHKIHRTGKTVDPTND 361 Pseudomon...
zhongguo:B5T_00252 282 vntd------llgntdlLVTTTGNFNVCDANMLKALKKGAVVCNIGHFDNEVDTAFMRKTWEWEEVKPQVHKVWRDKAEG 355 Alcanivor...
XP_002111388       296 ------------------IVITATGNKNVIRREHMNKMKNGCIICNMGHTNSEIDVDSLRTPDLTWERVRSHVDHIVWPD 357 Trichopla...
XP_001625738       318 ------------------ILITCTGNKNVVTREHLDRLKNGCIVCNMGHSNTEIDVASLRTSDLAWEKVRSQVDHIIWPD 379 starlet s...
NP_001074118       336 ------------------MVITCTGNKNVVVREHMDVMKNGCVVCNMGRSNTEINVSALKTPDLTWQHVRAQVDHIIWPD 397 zebrafish
P50245             332 ------------------VVVTATGNKNVITRDHMNRMKNGCILCNMGHSCSEIDVNGLHTPELTWERVRSQVDHIRWPD 393 fruit fly
XP_029698134       365 ------------------MVITCTGNKNVVVRKHLDRMKNGCIVCNMGHSNTEIDLASLRTAELRWERVRSHVDHVIWPD 426 torafugu
XP_019217049       407 ------------------MVITCTGNKNVVMREHLDKMKNGCIVCNMGHSSSEIDLAGLRSSDLKWVHVRPRVDHVIWPD 468 Nile tilapia
1V8B_C             379 NKIIVLARGRLLNLGCATGHPAFVMSFSFCNQTFAQLDLWQNk-dTNkYENK-----VYLLPKHLDEKVALYHLKKLNAS 452 Plasmodiu...
A4XPF3             363 DYLILLAEGRLVNLGNATGHPSRIMDGSFANQVLAQIFLFEQkfaDLpAEKKaerltVEVLPKKLDEEVALEMVKGFGGV 442 Pseudomon...
A4VRF7             362 DYLILLAEGRLVNLGNATGHPSRIMDGSFANQVLAQIHLYNEkfaDLpVAEKtqnvtVMVLPKKLDEEVALEMVKGFGGV 441 Pseudomon...
zhongguo:B5T_00252 356 DFLLLLSEGRLVNLGNATGHPSRIMDGSFANQVLAQMYLFDQgyaNHsDAVKekmlkVEVLPKHLDEEVAMYMVQGFGGV 435 Alcanivor...
XP_002111388       358 GRRIVLIAEGRLANLTCSNVPSFVVSITACTQMLALIELFK-------AQPNkykgdVYLLPKKMDEYVASLHLAGFEAQ 430 Trichopla...
XP_001625738       380 KKRIVLLAEGRLVNLSCSSVPSFVVSITATTQAIALIELYK-------APPGrykhdVYLLPKKMDEYVAMLHLPTFDAH 452 starlet s...
NP_001074118       398 GKRMILLAEGRVLNLSSSTVPIYVLSITATTQALALIELFN-------APEGrykqdVYLLPKKLDEYVASLHLQTFDAH 470 zebrafish
P50245             394 GRMIILLAEGRLVNLSCSTISSFVVSVASSTQALALIELFS-------AP-GryksdVYLLPKKMDEYVASLHLATFDAH 465 fruit fly
XP_029698134       427 GKRILLLAEGRLLNLTCSTVPSLVLSITTTTQALALIELYS-------APEGrykqdVYLLPKKMDEFVASLHLPTFDAH 499 torafugu
XP_019217049       469 GKRIVLLAEGRLLNLSCSTVPSFVLSITAATQAMALIELYN-------APEGrynkdVYLLPKKMDEYVASLHLPIFDAH 541 Nile tilapia
1V8B_C             453 LTELDDNQCQFLGVNKSGPFKSNEYR 478 Plasmodium falciparum 3D7
A4XPF3             443 VTQLTKQQAEYIGVTVEGPFKPDTYR 468 Pseudomonas mendocina ymp
A4VRF7             442 VTQLTAKQAEYIGVAVEGPFKPDSYR 467 Pseudomonas stutzeri A1501
zhongguo:B5T_00252 436 VTRLTAEQADYIGVSVDGPYKPDHYK 461 Alcanivorax dieselolei B5
XP_002111388       431 VTELSDDQCQYLGVARNGPFKPNYYR 456 Trichoplax adhaerens
XP_001625738       453 LTDLSDDQAKYLGVNKNGPYKPNYYR 478 starlet sea anemone
NP_001074118       471 LTELTDDQAKYMGLSKNGPFKPNYYR 496 zebrafish
P50245             466 LTELTDEQSKFMGLNKAGPFKANYYR 491 fruit fly
XP_029698134       500 LTELSEEQAKYLGISRSGPFKPHYYK 525 torafugu
XP_019217049       542 LTELSDDQAKYMGISKHGPFKPNYYR 567 Nile tilapia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap