4HA6,4H7U,4QI7


Conserved Protein Domain Family
GMC_oxred_C

?
pfam05199: GMC_oxred_C 
Click on image for an interactive view with Cn3D
GMC oxidoreductase
This domain found associated with pfam00732.
Statistics
?
PSSM-Id: 398739
Aligned: 75 rows
Threshold Bit Score: 71.6596
Threshold Setting Gi: 122015353
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4HA6_A            365 PTSR-GSVRISG--PELGDRL-----IIDPAYLQTGRD-RERFRRALEASRTIGHRD--ELa------------------ 415 Mesorhizob...
jgi:Rmet_5013     389 PRAD-STIRLSDs-RDCLGLC-----RTRLDWRISNHE-VDTIRAFAKVAQDSLAGI----------------------- 437 Cupriavidu...
Q11KP3            384 PLRE-SGLRLTGk-NDPQGMP-----IAEIDWRIDGQPeLETIATFSSLVADFLKRE--G-------------------- 434 Chelativor...
Q2N8A7            364 GHERdSRITLSDtlSDAHGTP-----LPAIDWTVTPAD-VEQLH----ALADIFERH--WDrg----------------- 414 Erythrobac...
Q98C76            406 DE---NFVTLDE--DDN-----------AFVSFKAPSD------YAVKGMARALDKL----------------------- 440 Mesorhizob...
jgi:Shewana3_3396 380 PDSQgGQVHLTS-----TGF--------ALDYPLTEAF-WRAARRAYASMAELQFSA----------------------- 422 Shewanella...
WP_008249864      391 SGSVgGQVRLNS-----DGSP-------VLDYKLTPAI-WDAARRALVAMAELQHAA----------------------- 434 Limnobacte...
Q5BFQ7            563 PRSA-GFITLVRdrDPGRVYPdpndgRVRIDYDVSGFD-RNHMVEGLVATAKISYISgaREihtsyrdmppfirpaedkg 640 Aspergillu...
Q9ZWB9            600 DEGV-GEVKGD-----------------IVKYRLTKAD-EENLTIGLKQALRILVAA--GAaevgtyrsdgqrm----kc 654 thale cress
Q9P8D9            536 DTTS-GSVS-----ADPKKPE-----ALIVDYDVSKFD-KNAILQAFLITSDMLHIE--GAkrilspqawvpif----es 597 Candida tr...
4HA6_A            416 ----------gWRERELLPGtpn-----------saaEMDDFIAR--SVI-THHHPCGTCRM-GKDPD-AVVDANLRLKA 469 Mesorhizob...
jgi:Rmet_5013     438 ------------ARVSDPSLseapdds------------------iratcddMNHHMGGMRM-SASASdGIVDLDLKLHG 486 Cupriavidu...
Q11KP3            435 -----------LAQVSLDPRltardpg------------------flskiedGFHQMGMARM-GASPSdGVVDKDLRVFG 484 Chelativor...
Q2N8A7            415 ---------elAGLGTFERFpragveq------------------alvhsggIYHPTGSTRM-AASAAdGVVDADLRLFA 466 Erythrobac...
Q98C76            441 -------------PELLAPLpverlfd-------------------rgirpteSHVQGTLRM-GTGPAdSVIDSNMIHHR 487 Mesorhizob...
jgi:Shewana3_3396 423 --------------GALKVLpisdgmpylsswkeakeSIAQMDLAplRTVvASAHVMGGCPF-GEDEKlSMVNSFGQSHY 487 Shewanella...
WP_008249864      435 --------------GALSTLpvhefskpannidealkQINALDMKplSMKvVSAHVMGGCAM-AGEEKlGVARPDGRHWQ 499 Limnobacte...
Q5BFQ7            641 gsplgindpvfQAWIEELRRkapktsd--------------------rvmwasaHQMGSCRM-GTSPRhSVVDPDGQVWG 699 Aspergillu...
Q9ZWB9            655 dgikqkdleafLDTVNAPPGvvsmskh--------------------wtqsftaHQIGCCRM-GATEKeGAIDGKGESWE 713 thale cress
Q9P8D9            598 skprdersiddKDYVEWRAKaakipfd------------------sygsaygSAHQMSTCRMsGKGPKyGAVDTDGRLFE 659 Candida tr...
4HA6_A            470 LDNLFVVDASIMPNLTAGPIHAAVLAIAETF 500 Mesorhizobium loti
jgi:Rmet_5013     487 MDNGYVCSGAVFPTSSFSNPTHTVLALAVRL 517 Cupriavidus metallidurans CH34
Q11KP3            485 TDNLFVAGAAAFRPAGFPNPTLTAIALA--L 513 Chelativorans sp. BNC1
Q2N8A7            467 EPRVQLVGTSVLPSGGGANPTMTALLLAMRL 497 Erythrobacter litoralis HTCC2594
Q98C76            488 LRNLVVVGTSTYPSCSCANPSLTAAALSLRA 518 Mesorhizobium loti
jgi:Shewana3_3396 488 LDNLSVMDGSIFPTSLGANPQLSIYGITARN 518 Shewanella sp. ANA-3
WP_008249864      500 IENLSIHDGSLFPTSIGANPQLSIYGLTNKL 530 Limnobacter sp. MED105
Q5BFQ7            700 TKGLYVIDASIFPSASGVNPMITNMAIADHL 730 Aspergillus nidulans
Q9ZWB9            714 AEDLYVCDASVLPTALGVNPMITVQSTAYCI 744 thale cress
Q9P8D9            660 CSNVYVADASVLPTASGANPMITTMTFARNI 690 Candida tropicalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap