5LMT


Conserved Protein Domain Family
IF3_N

?
pfam05198: IF3_N 
Click on image for an interactive view with Cn3D
Translation initiation factor IF-3, N-terminal domain
Statistics
?
PSSM-Id: 398738
Aligned: 470 rows
Threshold Bit Score: 47.025
Threshold Setting Gi: 511005141
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5LMT_X         6 TNERIRAKQVRVVGPDGKQLGIMDTREALRLAQEMDLDLVLVGPNADPPVARIMdYSKWRYEQQMAEKEA 75  Thermus thermophilus HB8
XP_016082256  80 VGRKIQHRILQVLDEQGEDLGAMHRADVIRLMEERGLRLVLLRPATEPPLYQLL-TGSQIHEERLRLREK 148 platypus
XP_012400665  77 VGRKIHHRIVHLLDSNGNSLGSMHRADVIRLMEQQDMRLVLRKANVDPPVYQLM-TGKQIHEEQLRLREi 145 Tasmanian devil
XP_003414000  79 VGRKIRDGIVQVFDEKGNDLGHMQQADVIELMNTRELRLVKRITRAEPPVYQLM-TGLQIHEERMKLRER 147 African savanna elephant
Q32KZ1        73 VGRKINERIIHVLDEQGNDLGHMHRANVIRLMAERDLRLVKRDASAEPPQYQLL-TGAQIHQERLRLREA 141 cattle
XP_013962879  80 IGRKIHERVIHVLDEAGNDLGSMHRAEVIRLMAERDLRLVKRDSGSEPPRYQLL-SGLQIHEERLRLREm 148 dog
XP_005317109  78 IGRKIGERIIRVLDEKGNDLGNMHRADAIRLMEERDLRLVRRNASTEPPEYQLM-TGTQIHQERLRLRdm 146 thirteen-lined ground squ...
Q9CZD5        75 TGRKISERIIRVLDEKGMDLGMMHRADVIRLMNKQDLRLVQRNTSSEPPEYQLM-TGEQIHQERLKLREQ 143 house mouse
XP_003477301  73 TGRKIHARIIRVFSEEGTDLGPMHRADTIRLMEERALRLVQRDADAEPPEYQLM-TGAQIHQERLRLREE 141 domestic guinea pig
XP_002824163  78 IGRKISQRIIHLFDEKGNDLGNMHRANVIRLMDERHLRLVERNTSTEPAEYQLM-TGLQIFQEQQRLREm 146 Sumatran orangutan
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap