5EIK,5EGI


Conserved Protein Domain Family
TRIC

?
pfam05197: TRIC 
Click on image for an interactive view with Cn3D
TRIC channel
TRIC (trimeric intracellular cation) channels are differentially expressed in intracellular stores in animal cell types. TRIC subtypes contain three proposed transmembrane segments, and form homo-trimers with a bullet-like structure. Electrophysiological measurements with purified TRIC preparations identify a monovalent cation-selective channel.
Statistics
?
PSSM-Id: 398737
Aligned: 36 rows
Threshold Bit Score: 208.96
Threshold Setting Gi: 968115624
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5EIK_A               51 AISFSRKHPFSCWLSCMLMSFAGSFLSCFLLGEPIISPLKQHADILLGSIVWYLVFYSPFDVVFRLATWFPVKLGLSVLK 130 Caenorha...
CUT99039             43 SGAFSRKHPFACWFATMLMCFGGAILGNFILGEPIFACFDDHRAVLTATAVWYLINYSPFDVVYKIYSLFSVRLLVCVMK 122 Echinoco...
XP_001623406         41 GTGFAQSNPLACWISAVISNFAGSFLISFFLGLPMVLPLKDVRAVAAMTTIWYLVFYCPFDIFNKFFMLQPAWLSLVVLK 120 starlet ...
XP_015788302         73 AHKFSRRHPFSCWASTMLSFFSGSLLANFFLAEPLTDVFKSSQTVVLATLTWYIVFYSPFDIVCKLISLRPCYILLDCAR 152 two-spot...
EFX72042             43 SIPFSRKHPIACWLSTMMVTFAGGFLAALFLGEPLLEPFRNTQSVLLATAVWYAMFYSPFDIIYKLSKFLPIKIVIAAMK 122 common w...
XP_008184593         42 ALAFSRKHPISCWLSTMLVVFAGGMLSAALLGEPPLAPLKNTQQLLIATAVWYLVFYTPFDIGYSIAKFLPVKLVFSVMK 121 pea aphid
XP_015026426         42 AQAFSRKHPLACWLSTMLVIFAGGMVANGLLGEPILAPLKNTGQLLVGTAVWYLVFYTPFDIGYKVAKFLPVKIVASAMK 121 Drosophi...
XP_001983406        156 AKRSTKQRPFVLWLTNLLVTYAGEILVNMLLGTLPLKPLSNVQDILLCSAAWYLIFYSPFDCAHSLACSVLFRLLAAPVT 235 Drosophi...
XP_002046225         45 eRSCLEMRPFVLWLTHILVSYSGDILVNLLLGTLPLEPLSNYHDVMLSTFAWYIIFYSPFDVAHSVARTTPFRCLATPVA 124 Drosophi...
WGS:AAPU:GI16529-PA  38 grrSQKMRPFTLWLTHILLSYAGDILVSLLLGTLPLEPLNNAQDVALCTAAWYIVFYSPFDVAYVVARTAACRCLIAPVT 117 Drosophi...
5EIK_A              131 EVQRTHKIAAGVKHAVRIY-PESYLVQILVGVAKGAGSGVVKIVEQLARGTWHPTNHEILRPSFTTKACVIASIVFTLEr 209 Caenorha...
CUT99039            123 EVQRSKKISLGVSHAYHDY-PHSAVTCILVGLLKGTGYLEMKIFARLVRGVWLPASTEFLHPSFTTKISLLSAIVFYCD- 200 Echinoco...
XP_001623406        121 EAHRAKAILGGVSMGLEHY-PTDLLVVVLVGIFKGAGALLVQPVAAVVQGSLDVTSHEALKPSFTTKASIVASILYTLV- 198 starlet ...
XP_015788302        153 EILRAKVVYTGVTHTARIY-PGNYAIIIFIGALRASGGCFLRPLDRLFRGIWTPNIIEMLNPSYPTKTALLASAIFTVNk 231 two-spot...
EFX72042            123 EVYRCKKVYDGVNHAAKLF-PNAWMILFITGLVKGNGGSFIKILERLVRGVWTPTAFEFLQPSFPTKACIVASIIFVLDk 201 common w...
XP_008184593        122 EIYRCKKVHDGVLHAAKLY-PNAYIIMVLIGTLKGNGASFTKIIERLLRGVWTPTSIETLQPSFTTKACIIASVVFVLDi 200 pea aphid
XP_015026426        122 EIYRAKKVYDGVGHAAKLY-PNAWIIMIIIGTLKGNGAGFTKLIERLIRGAWTPTAMEFMQPSFYTKASLLASIIFVLDk 200 Drosophi...
XP_001983406        236 AISQILHIERGVQLAVKMYgNNAMVPILIVGTVIGSGAEFLKPVAALFINRCQLNNAAYVKLSTNSKVSLGITWLFLLQl 315 Drosophi...
XP_002046225        125 ALSQVLHIERGVHLASKVYgKNSLVPVIIIGTVIGSGAEFLKPVAALLINRCQMKPAAYIKLSTNSKLAIAISWLYLLQl 204 Drosophi...
WGS:AAPU:GI16529-PA 118 ALNQVLHIERGVQLATKTYgRTATLPILIIGTVIGSGAEFLKPVAALLINRCQLQNVAYVKLSTNSKLALLVTWLYLVQl 197 Drosophi...
5EIK_A              210 --HSMYVTAPHDLVYLCVVGFFIYFKLA 235 Caenorhabditis elegans
CUT99039            201 --LLDLIPLSRHQLFLAVVGVLVYMRVA 226 Echinococcus multilocularis
XP_001623406        199 --LKGIISISTECLCFGVFLVFALIKVS 224 starlet sea anemone
XP_015788302        232 --QSDWINISTPLVYLAVVSLLIYLKFS 257 two-spotted spider mite
EFX72042            202 --KTELISAPHALVYFGIVIFFVYFKLS 227 common water flea
XP_008184593        201 --KSDLISAPHAFVYVFVIGFFIYFKVF 226 pea aphid
XP_015026426        201 --KTDWISAPHALVYFGIVIFLVYFKLS 226 Drosophila virilis
XP_001983406        316 nkSRLLLGLGKNQLQLYVLFMLMCFKYM 343 Drosophila grimshawi
XP_002046225        205 ngSQLLFGLSRCQLQLYALLALMCFKFl 232 Drosophila virilis
WGS:AAPU:GI16529-PA 198 nhSRLLLGLRRCQLQLYVLLALTIFRIl 225 Drosophila mojavensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap