4RT4,6BX3


Conserved Protein Domain Family
Dpy-30

?
pfam05186: Dpy-30 
Click on image for an interactive view with Cn3D
Dpy-30 motif
This motif is found in a wide variety of domain contexts. It is found in the Dpy-30 proteins hence the motifs name. It is about 40 residues long and is probably formed of two alpha-helices. It may be a dimerization motif analogous to pfam02197 (Bateman A pers obs).
Statistics
?
PSSM-Id: 398726
Aligned: 14 rows
Threshold Bit Score: 59.5477
Threshold Setting Gi: 1474892396
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4RT4_D  12 PTRAYLDQTVVPILLQGLAVLAKERPPNPIEFLASYLLKNKA 53  human
Q9W1Z4  22 EQGKYLADSLADPLIKALTEIANKRPRDPVAYLTNYLQHFMG 63  fruit fly
Q9D9T0   1 MESRYLQKCLGTCLTQGLTEVARVRPLDPIEYLAFWLYKHKE 42  house mouse
Q9D3X8   1 MDTAYLKNCFGTGLTQALAEVARVRPSDPIEYLAHWLYHYRS 42  house mouse
Q9VZJ1  47 PVRQYLDQTVAPILLHGLQALARDRPSDPISYLATYLLKNKN 88  fruit fly
O74861   6 PARQYLNEKVTPVLLEGMKILARDRPENPLQFLGQFLLDANA 47  Schizosaccharomyces pombe 972h-
6BX3_M   1 -TRKYLNTNVTPHLLAGMRLIAVQQPEDPLRVLGEYLIEQSN 41  Saccharomyces cerevisiae S288C
P56597 156 AAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNP 197 human
Q99MH5 156 AAKDYINLYVAPTLLQGLTELCKEKPPDPYLWLADWLMKNNP 197 house mouse
Q9D2H2 570 PLRNYLMTYVMPTLMQGLNECCKVRPEDPVDFLAEYLFKNNP 611 house mouse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap