1NKL


Conserved Protein Domain Family
SapB_1

?
pfam05184: SapB_1 
Click on image for an interactive view with Cn3D
Saposin-like type B, region 1
Statistics
?
PSSM-Id: 398724
Aligned: 442 rows
Threshold Bit Score: 25.9916
Threshold Setting Gi: 183231856
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1NKL_A           4 CESCRKIIQKLEDMVGPQPNEDTVTQAASQV-CDKLK 39   pig
14_pfamImport    3 CSDCKAFLGDIDALLGNTTFQNLIIQELDTViCASLP 39  
Q7T3Q1          47 CWACKWALGKVKRKISNGATQDEIKVQLSQV-CDQIG 82   zebrafish
XP_001623555   130 CITCQEAVNTVYKFVSNPAIEDEIVALLSKV-CSEFG 165  starlet sea anemone
XP_001623555    25 CTTCKELVKTIYTMASDPTAQNQILSLIKDA-CTFLG 60   starlet sea anemone
XP_018645371   258 CPNCLSVLNQFKTGVGDPAIQERLKQLIDEKvCTHMG 294  Schistosoma mansoni
XP_019927939   271 CDLCKEVMSKVRDMDRDPTNQEKIKAYIKTDlCEKLG 307  Pacific oyster
XP_030835042   250 CSTCKTTMTTIDSMLSNSAIQSAIVLGLDQF-CSSLG 285  purple sea urchin
XP_030835042   335 CTDCTTFFGDIDGMLTNQTVQNMILAAVDDI-CAEFG 370  purple sea urchin
XP_030835042   479 CTDCEQFLTDVQAKLNDPNVQNTIVNAVESV-CTLFG 514  purple sea urchin
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap