2H7A


Conserved Protein Domain Family
YcgL

?
pfam05166: YcgL 
YcgL domain
This family of proteins formerly called DUF709 includes the E. coli gene ycgL. homologs of YcgL are found in gammaproteobacteria. The structure of this protein shows a novel alpha/beta/alpha sandwich structure.
Statistics
?
PSSM-Id: 398709
Aligned: 76 rows
Threshold Bit Score: 89.8525
Threshold Setting Gi: 503301774
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2H7A_A           16 CVIYRSSKRDQTYLYVEKKDDFSRVPEELMKGFGQPQLAMILPLDGRKKLVNADIEKVKQALTEQGYYLQLPP 88 
CBL46945          4 CSIYKSPKKEGMYLYVPRKELFAKVPEALMDAFGRPAHVMDMLLQPGKKLANADIDKVMAEVREKGFYLQMPP 76  gamma proteobacteri...
B3PKG9            5 aEIYRSPKEEGMYLYVKKEEGLGRVPEELLTLFGKPQQAMVLLLTPEKKLANADIGKVIESLNDKGYYLQLPP 77  Cellvibrio japonicu...
Q2SIW7            8 iSIFRSSKKEEMYVYVDKKQGVGALPEALLQLFGKPQHVFDLLLTKEKPLARADAAEVMSAIDEKGFYLQMPP 80  Hahella chejuensis ...
A6VYC0            7 VEVFRSSKHDGMYLYVEKSKGLKEIPEELMTRFGKGISAMTMLLTNESKLARATPENVTKGIREKGFYLQLPP 79  Marinomonas sp. MWYL1
jgi:Marme_2345    6 iEIFRSSKKDEMYLYVEKSKGLTEIPEALMERFGKGISAMTMLLTEESKLARADASAVMKAIQEQGFYLQLPP 78  Marinomonas mediter...
Q1QXJ3            6 CEIFKSPRRDEMYLYVDRARGLADMPEALLERFGKPVPVTVLMLSEDKPLARAKASDVLAAIEAQGFYLQMPP 78  Chromohalobacter sa...
CBV41943         10 CEVFKSPRKDEMYLFVDKTQGLAEVPEALLERFGEPVSTMSLLLTPEKRLARTTGADIMAAIEEKGYYLQLPP 82  Halomonas elongata ...
tigr:TERTU_2738   6 VDIYRSARKEGMYLYVRKGYDLEQLPAALLSQFGRAEHAMGMLLTAQKKLARADAQAVMAAIEAQNFYLQMPP 78  Teredinibacter turn...
Q21L28            3 VDIYRSAKKEGMYLYVPRNKALDELPEPLMKQFGRADHSMVLVLTPEKKLARASVEKVIESIENQGFYLQMPP 75  Saccharophagus degr...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap