6CNB


Conserved Protein Domain Family
RNA_pol_Rpc34

?
pfam05158: RNA_pol_Rpc34 
Click on image for an interactive view with Cn3D
RNA polymerase Rpc34 subunit
Subunit specific to RNA Pol III, the tRNA specific polymerase. The C34 subunit of yeast RNA Pol III is part of a subcomplex of three subunits which have no counterpart in the other two nuclear RNA polymerases. This subunit interacts with TFIIIB70 and is therefore participates in Pol III recruitment.
Statistics
?
PSSM-Id: 398703
Aligned: 14 rows
Threshold Bit Score: 318.91
Threshold Setting Gi: 74684488
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6CNB_P         4 MIENG-----LQLSDNAKTLHSQMMSKg-IGALFTQQELQKQ--MGIGSLTDLMSIVQELLDKNLIKLVK--QNDE-LKF 72  Saccharomyces c...
Q4WAM7         1 MASAGps--gSSINELASKLYDECLKRydSDHLFYQQDLLGLgvVERNNLPLLLQCTQLLVDQKLFRLLQg-KNDR-LAW 76  Aspergillus fum...
Q2U284         1 MASAGas--gASVTELASKLYEHCLNNypPDQLFYQQDLLGLgiVPKSDLALLLRCTQSLVDQKLFRLLQg-KNDR-LAW 76  Aspergillus oryzae
Q7SEF1         1 MADRD------KIQILKDALYEAARDHgsDQRLFTQRDLLDMqvIPQDNIGLLMQVIQILCDEKLFVGNT--TASG-LSW 71  Neurospora crassa
Q756R3         4 LIQNN-----IKLSDTAQELHDKMIGMq-PGTLFSQQELQAM--IGSPSLSNLMAHAQELLDKNLIRLVK--QNNE-LRF 72  Eremothecium go...
Q2HEQ1         1 MASDKgddgaAKLQILKDALYDEMRQHgsEARPFSQKDLNDLniIPNNDVNLLLSVVQRLCDDKLLVGIAn-HHAG-MAW 78  Chaetomium glob...
XP_001628610   3 VADIVikqeaVEAVDLQDRILELCKGT---PKGISDRTILQD--MPSVSAEQRVAAINRLLSTGKIELLK--SGSQ-LLY 74  starlet sea ane...
Q921X6         3 evkvkvqppdaDPVEIENRIIELCHQF---PHGITDQVIQNE--MPHIEAQQRAVAINRLLSMGQLDLLR--SNTG-LLY 74  house mouse
Q5KEY6         4 MSTAD--------QQVWKKVLAAKNKN------MSLTQIEAS--FPTMSKKAVMSSVTTLLKLRLLSQVKgkGDDKaMVY 67  Cryptococcus ne...
Q57WC7         1 MTSVP------GVNNAEQRILASLALA--GQGALLLATLQQD---LGLHHRTMAAALRGLMEGGRVVLRHgnREGD--MY 67  Trypanosoma brucei
6CNB_P        73 QGVLESEAQKKATMSAEEA-LVYSYIEASGREGIWSKTIKARTN---LHQHVVLKCLKSLESQRYVKSVKSVKFPTRKIY 148 Saccharomyces c...
Q4WAM7        77 KIISREDAEKLQNLSPDES-LVYNVIHSTGRNGIWVRAIQSRTN---LHKSILDRCLKSLEGKSYIKSVHNVKFPSRKMY 152 Aspergillus fum...
Q2U284        77 KIISREDAEKLQNLSPDES-LVYNVIHSTGRNGIWVRAIGTRTG---LHKSILDRCLKSLEGKNYIKSVHNVKFPSRKMY 152 Aspergillus oryzae
Q7SEF1        72 RWRSREDAKKYTSLPNSEImMVYAMVDEAGADGIWNRTIKNKLN---MADSLMKHCIKYLEQKGYIASMKNVEHPNKKMY 148 Neurospora crassa
Q756R3        73 QAVNVSEAQKKSGMSSDEA-LVYSYIEASGREGIWTKTIKAKTN---LHQHVVLKCLKSLESQRYVKSVKSVKYPTRKIY 148 Eremothecium go...
Q2HEQ1        79 RWRSREEAKKYTSLPNDEAvMVYSIIDEAGADGIWNRTIKNKLN---MHEAVVKNCIKFLETKGYIASMKNVEHPNKKMY 155 Chaetomium glob...
XP_001628610  75 KYKDDQQTNQKTKGFELEEkLVYQTIEESSNKGIWIRDIRYKCN---LQMTQLNRIIKTLESKKLIKAVKSVAASKKKVY 151 starlet sea ane...
Q921X6        75 RIKDSQNAGKMKGSDNQEK-LVYQIIEDAGNKGIWSRDIRYKSN---LPLTEINKILKNLESKKLIKAVKSVAASKKKVY 150 house mouse
Q5KEY6        68 HAQTPEEAKQKATLTQEQS-IILSIIRSAGNRGIASAQITRTIGtdtMPISMLRKVLKTLESEGHIKQFKPVNAPTSVYY 146 Cryptococcus ne...
Q57WC7        68 VAL-------VNSMPEGPS-LVLDAIRASGNSGIDQAALCSSLR---LPKGEIIKSLQMLLSQKRIKERRCFSNRAKRIY 136 Trypanosoma brucei
6CNB_P       149 MLYSLQPSVDITGGPWF--TD-GELDIEFINSLLTIVWRFISENTFPNg------------------------------- 194 Saccharomyces c...
Q4WAM7       153 MLAGLAPSEDVTGGAWF--TD-GVLDANFISTVAGFIEYTVSRKSWYEvpatgnkrl----------------------- 206 Aspergillus fum...
Q2U284       153 MLAGLAPSEDVTGGAWF--TD-GVLDENFINTVAGYIEYTVSRKSWVEvpsadahrtk---------------------- 207 Aspergillus oryzae
Q7SEF1       149 IKANLRPSDRATGGPWF--TE-GELDTAFINELQEIVFDFIKQKSTYTshgggagvpgvgaqgggaqqreknpkkgvvqg 225 Neurospora crassa
Q756R3       149 MLYNLQPSIDVTGGPWF--TD-SELDVEFINSLLTIVWRHTSERTYPNg------------------------------- 194 Eremothecium go...
Q2HEQ1       156 IKATLRPSERATGGPWF--TE-GELDTAFISELEGIVFEYIKTKSAYRgsqpvpggaaasagatkapkkgvvtaget--- 229 Chaetomium glob...
XP_001628610 152 MLFNLEPDESVTGGAWY--SD-QDFEAEFVEVLNQQCFKYLEQKAE---------------------------------- 194 starlet sea ane...
Q921X6       151 MLYNLQPDRSVTGGAWY--SD-QDFESEFVEVLNQQCFKFLQSKAETAr------------------------------- 196 house mouse
Q5KEY6       147 ILAHLKLPEEISGGVWF--DDnKEYDQGLVETICAVLLNRVRTATYVDdkkrsq-------------------------- 198 Cryptococcus ne...
Q57WC7       137 LLFEFEPSDEVTGGTFYggEDsREMDIGFVDEMRRRIMLLVAQRHSVSleqitq-------------------------- 190 Trypanosoma brucei
6CNB_P       195 -----------------------------fKNFENGPKKNVFYAPNVKNYSTTQEILEFITAAQ--VAN---------VE 234 Saccharomyces c...
Q4WAM7       207 ----------------------ktadgrasVKQESGEKKYLPYPAGYQGYPTVAMITAAVNESG--ITP---------VR 253 Aspergillus fum...
Q2U284       208 --------------------riktsdgsvsVKQEAGQKTFIPFPAGYRGYPTVSMLTDAVNESG--ITP---------VR 256 Aspergillus oryzae
Q7SEF1       226 tiphsediskgtkrsageisnddtaapapakktrpgKPQLLPLPAGYKSYPTVSDIAKFIHHAG--ITNn--------TT 295 Neurospora crassa
Q756R3       195 -----------------------------fNNFGTGRDKEVLYTHTVKNYSTTEEILKFISAAR--VST---------VE 234 Eremothecium go...
Q2HEQ1       230 -targtkrsateisnddaptatgraangstATGTKSRAVFLPMPAGYKHYPTVAEIAKFIHDTG--ITNn--------TT 298 Chaetomium glob...
XP_001628610 195 ------------------------------------KLHADPVARRNASYAPAEDVWKYITQLG--ISK---------VQ 227 starlet sea ane...
Q921X6       197 ------------------------------------ESKQNPVIQRNSSFASSHEVWKYICELG--ISK---------VE 229 house mouse
Q5KEY6       199 -------------------------------eakslVPNALNTSSKYYSLLTPMALRTYVNKLG--VTS---------AT 236 Cryptococcus ne...
Q57WC7       191 ------------------------hlqearGGSSSADVNATAGGTVVMTTSPNGTVATLLGDSTgsCSGggsvgagcvKR 246 Trypanosoma brucei
6CNB_P       235 LTPSNIRSLCEVLVYDDKLEKVTHD------CYRVTLESILQMnQGEGE------------------PEAGNKALE-DEE 289 Saccharomyces c...
Q4WAM7       254 LGEESIIQLLEMLCYDKKLVALNNGqf--ykSVKNPAAVKMEKnRKPEGdved-----------vgdKLVTNGMTEvPCG 320 Aspergillus fum...
Q2U284       257 LGEESITQLLDMLCYDGKLVALNSGem--ykSVKNPEAVKQSQaRKPAGedkg-----------iddRLVTNGMTEaPCG 323 Aspergillus oryzae
Q7SEF1       296 LSEADIQQLVDVLYYDGLVEPVKVNgrkgyrVTRIPKQDPRTC-NQRRLdhdptkgg--ivtsfmgvEPSASGLMEaPCG 372 Neurospora crassa
Q756R3       235 LSKSDIRSLCEVLVYDGKLEKVAFD------CYRVTLQSVLQMtQ----------------------PAGGEPGAGvADQ 286 Eremothecium go...
Q2HEQ1       299 LGESDIQQLVDVLSYDGLIERVRVGrrrgyrVARALKQDTVPF-HKRQKereagvgl--dlplvpgaEPLASGLTEaPCG 375 Chaetomium glob...
XP_001628610 228 LSVHDIETILSTLIFDGRVETTIVSag--tsTSRTAVSGQKTLyra------------------ifpIVPSTGLMTsPCG 287 starlet sea ane...
Q921X6       230 LSMEDIETILNTLIYDGKVEMTIIAak---eGTVGSVDGHMKLyra------------------vnpILPPTGVVRaPCG 288 house mouse
Q5KEY6       237 LSVKNVMECMRALELDGLVEVVKPVgg--vhLQEESDDESTARsSKRR-------------------------KVEsDSE 289 Cryptococcus ne...
Q57WC7       247 ISQRDAQLLVQTLVLDGLLDCVTPSpavpaqYQLATGRNVMRHfSAVPTaagagsgtkwvpapvsqpSAWAMPAVGlPCM 326 Trypanosoma brucei
6CNB_P       290 EFSIFNYFk-MFPASKHDKEVVYFDEWTI 317 Saccharomyces cerevisiae S288C
Q4WAM7       321 PCPVFKLC--VPGGAVSPETCEYFDPWLQ 347 Aspergillus fumigatus
Q2U284       324 TCPVFKLC--APGGAVSPESCEYFDPWLE 350 Aspergillus oryzae
Q7SEF1       373 RCPVYDMC--EEGGPVSPSNCVYFRRWLD 399 Neurospora crassa
Q756R3       287 DFSVFDYAs-VISPSAGDKEAVYIDEWNL 314 Eremothecium gossypii
Q2HEQ1       376 RCPVFDLC--EEGGPVSPSNCVYFLQWLD 402 Chaetomium globosum CBS 148.51
XP_001628610 288 VCPVIDHC--RDGAAISPKTCIYMKDWLD 314 starlet sea anemone
Q921X6       289 LCPVFEDC--HEGGEISPSNCIYMTEWLE 315 house mouse
Q5KEY6       290 DEDR-DKE--REKAKMKAKEKAKMKKRRE 315 Cryptococcus neoformans
Q57WC7       327 GCAQLHVCtaSGNGVVNPRNCAYLKEWMS 355 Trypanosoma brucei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap