3E59


Conserved Protein Domain Family
DIT1_PvcA

?
pfam05141: DIT1_PvcA 
Click on image for an interactive view with Cn3D
Pyoverdine/dityrosine biosynthesis protein
DIT1 is involved in synthesising dityrosine. Dityrosine is a sporulation-specific component of the yeast ascospore wall that is essential for the resistance of the spores to adverse environmental conditions. Pyoverdine biosynthesis protein PvcA is involved in the biosynthesis of pyoverdine, a cyclized isocyano derivative of tyrosine. It has a modified Rossmann fold.
Statistics
?
PSSM-Id: 398694
Aligned: 116 rows
Threshold Bit Score: 254.373
Threshold Setting Gi: 81544687
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3E59_C        51 AAFIEAGEPIEFVLPAFPAKSPNP-GKVLDSRPDMAERLSLSFLNHLCQRIQLFYAPGAKITVCSDGRVFGDLVRIGDAH 129 Pseudomonas aer...
XP_002616645 159 QFFTSRNAQVEAVLPAFPCKSSNP-EKVASTTPDKGEELALKRIIEFVSYVNEIYPPGMKFFIVSDGHVFSDCINVDDKV 237 Clavispora lusi...
EDK45086     153 DFFTTKSQPIEAVLPGFPCKSSNH-EKVFSELPDKGEELALRRLIYFAREVKKVYPPGIIIWIVSDGHVFSDCIAVDDLK 231 Lodderomyces el...
CCE42742     163 EFFTSRGQPLEAVLPAFPCKSSNY-EKVSGDLPDKGEELALQRLIYFAQEVKKIYPPGILIWIVSDGHVFSDCIAVDDTK 241 Candida parapsi...
XP_007585686  96 lDFVTRRLPIRFCLPAFPCKSPSA-EKTTGKLPDRAEYLALKALDEFARQVGDIYSPGAIVLIVSDGHVFSDLLEVRDDN 174 Neofusicoccum p...
EEP75704     186 YGFVDKGLPVIFCLPAFPCKSPNP-QKVGGEYPDAAEYYALVTLLDFLRAVSLVYKPGAILWIISDGHVFSDCIGVDDIK 264 Uncinocarpus re...
Q0U0L7       147 SSFVARGERIQMALPAFPCKSPST-RKVGGIYPDMAEHIALTTLHGFVEDVKAIYAPGVAVWIISDGHVFSDCIGVDDDT 225 Parastagonospor...
XP_008027087 192 YGYVDKNLPIQLALPAFPCKSPNP-NKVGGIMPDLAEHIAMDALHDFVKEVNTVYPPGATMWIINDGHVFSDCIGVDDEM 270 Exserohilum tur...
Q5B9S5       176 YLFIKDNKKIEFCLPAFPCKSSNP-DKVAGVVPDAAEYLALEHLNDFVQKVGSIYEPGATLWVISDGHVFSDCIGVDDAL 254 Aspergillus nid...
KAE9158740    58 ARFVDRNEPITVVLPGFPTKTPNHgGKVLGPLPDRAEELALARLEKLCASVEEVYPVGCKVTIFSDGRVFGDLVGASLEN 137 Phytophthora fr...
3E59_C       130 ISAYQDALRLMIEEIga----------tH-IGVFNLEDVRafe-----------------------aqRDNHEQLRQLLI 175 Pseudomonas aer...
XP_002616645 238 VDSYTEQLKKLYHRVkpe--------gfDgIHFRGLNDCFksstkneiaplln---titvdhyldthlDDATEINRKIMM 306 Clavispora lusi...
EDK45086     232 VNRYSSALRQLYRQIssnggiegpseldDcIKFCSLPEIFnlkasfnceive----hvelghyldtelDAESELCRKILM 307 Lodderomyces el...
CCE42742     242 VNRYSAALKQMYKRIkpt--------dsSsIKFCSLPEIFefskdlpamvdh-----velghflsteiDPVSEVCRKILM 308 Candida parapsi...
XP_007585686 175 VDIYGEALKQMYYRMkssk------qcnGnIQFTSLTEIFfgnqevtelfqeawieghelthpidserSENAELCRKLMM 248 Neofusicoccum p...
EEP75704     265 VDEYKDRLMEMHNEIctde------kqrGyIQFMGLQEIFlsdpdltnqlspawmknielahpvgtklTEDAELCRKLLM 338 Uncinocarpus re...
Q0U0L7       226 ICKYDRALLKTYQSLytsn------edhQaIRFRGLTDILfsnfdaqasfrrdwfhglsiehpicskrTDEAELARMIMM 299 Parastagonospor...
XP_008027087 271 IDTYDACMAAIYKERypdd-----vgpvPtIKFKGLKNIFaadsdgfrdlqklllnshqmphpvktklTGDAELCRKLML 345 Exserohilum tur...
Q5B9S5       255 VDSYGAILASQYKATtknq------psnSnIQFTGLEDLFfsspestssfstnmldsisipqpietvlTESAQKCRLLLD 328 Aspergillus nid...
KAE9158740   138 IRAYKNGLKELVKEAgh----------tH-IQFDGLEN------------------------------YTKTDNPVQEVL 176 Phytophthora fr...
3E59_C       176 GGYAEPLESIRETLL-ASEEGLLLYRAITRFLYEDG--LTPDYQGSKTALQRDAKERAYGVIQRSWAWGALLADQFPRAI 252 Pseudomonas aer...
XP_002616645 307 LGCDDNAETLREEIKtPSHPRLYLYRGFNKFMYEDLvnTPKAQAMSRKKFKKMVSSIAFEMILRNDAYSNLVELVFPFHL 386 Clavispora lusi...
EDK45086     308 NSCDTDNGKLAAEVKtPGHPRLSLYRGFSKFMTEDLqfHPKVGSWTRKKFKKIASQVAFEMIKRNDAYSNLVELMFPFHL 387 Lodderomyces el...
CCE42742     309 TSCDTDNGKLREDIKtPGHPRLYLFRGFSKFMTEDLqfHPNVGKMTRKKFKKIVSQVAHEMIKRNDAYSNLVELMFPFHL 388 Candida parapsi...
XP_007585686 249 ALGQNDKAIMRGLITsQDPSTLGLYRGLSRFMLDDLskSRAFAGLSVSKRKKISSNVAAEMIVRNCAYSNLVELLFPSHV 328 Neofusicoccum p...
EEP75704     339 EMCQTDRGYLRKLIQeQESHALQMYRGLSRFMLRDLgsHSSMKGLSSKQQKKLSSSVATEMILRNQAYSNLVELLFPNYV 418 Uncinocarpus re...
Q0U0L7       300 TGFQTSKEHFRKLIAdQHEHALKLYRGQARFMQDDLf-cPKFLAMSTKQRKKTSFAVAAEMIARNQAYSNLLELLLPNYV 378 Parastagonospor...
XP_008027087 346 GIGGPDRTYIRQLIEqQEPDALGLYRGQTRFMLEDLadIPSVKSMSGKQKKKTAALVAEEMMSRNQAYSNLTELLLPNYV 425 Exserohilum tur...
Q5B9S5       329 TVGGIDRKHLRGLIDrKHSETLALYQGQSRFMLEDLgaYLSERNIGSKARKRIASKVAEEMIARNHAYSNLVELLFPHHV 408 Aspergillus nid...
KAE9158740   177 ERFGINQMDMDARIA-NEPDIGNNFRSFSQFMERDM--ADRWAGKSEAEMRKGCDDVARKMMLRNVGFSSLVAEEYAHAV 253 Phytophthora fr...
3E59_C       253 RLSIHPQpADSLKFGIHMMP--TRDDW--------------------------------LTPWHGVAV-NTEDRFVLMKR 297 Pseudomonas aer...
XP_002616645 387 RLSIHAHhNAGPKYGIRLLD--T---Siccsydhnp--------------deedrllhiPTPWHNAVFkLGDREKMIVSN 447 Clavispora lusi...
EDK45086     388 RFSIHAHnNAGPKFGISLLR------Gqcypinsiqdh----------rtpihtdllhiPTPWHNSVVkINE--LYYAIK 449 Lodderomyces el...
CCE42742     389 RFSIHAHnNAGPKFGISLLS--KNGTEkclpiesiqdh----------keprctdllhiPTPWHNSIVkINDDETYYVIK 456 Candida parapsi...
XP_007585686 329 RLSIHAHdNSGPKFAVRLLG--P---Ntaiavedletr----------daqksldnyhtPTPWHNCLAyVEGESVPYLIK 393 Neofusicoccum p...
EEP75704     419 RLSIHAHnNKGPKFGIKLFP--K---Stvrsissletr----------hethttddfhlPTPWHNSIIkVSGDRHMYLTA 483 Uncinocarpus re...
Q0U0L7       379 RLSIHAHsNRGPKFGIRLFP--T---Tkvraiesivdr----------haicpsyefqvPTPWHNSMIkIEGDDMLYLGK 443 Parastagonospor...
XP_008027087 426 RLSIHAHnNAGPKFAIRLLP--A---Nkvraidsletr----------lepnpvyeyqlPTPWHNCMIkVEGDDFMYLAK 490 Exserohilum tur...
Q5B9S5       409 RLSIHAHtNAGPKFGIRLFP--RGAVRaaptaqailsisqsksesesgaitnplyefqiPTPWHNCLVrVEGLEGMLLTR 486 Aspergillus nid...
KAE9158740   254 RVSIHCYnNAGPKFGIHLLPakRMDTP--------------------------------RTPWHSVICeDVDGTVRAMDL 301 Phytophthora fr...
3E59_C       298 SEVLELGGEL 307 Pseudomonas aeruginosa
XP_002616645 448 SKLAEMlekd 457 Clavispora lusitaniae ATCC 42720
EDK45086     450 AEKVEDEFAK 459 Lodderomyces elongisporus NRRL YB-4239
CCE42742     457 AAKVNQDLET 466 Candida parapsilosis
XP_007585686 394 ARAAYDANAK 403 Neofusicoccum parvum UCRNP2
EEP75704     484 ADVAHAging 493 Uncinocarpus reesii 1704
Q0U0L7       444 AEIVHKALEA 453 Parastagonospora nodorum SN15
XP_008027087 491 AQVARKAMQS 500 Exserohilum turcica Et28A
Q5B9S5       487 SGIIRDAISK 496 Aspergillus nidulans
KAE9158740   302 KDVDTDKYDL 311 Phytophthora fragariae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap