Conserved Protein Domain Family
GvpK

?
pfam05121: GvpK 
Gas vesicle protein K
These proteins are involved in the formation of gas vesicles.
Statistics
?
PSSM-Id: 398680
Aligned: 50 rows
Threshold Bit Score: 58.3336
Threshold Setting Gi: 122365039
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Halru_1918   3 TIDVDGESAADGLLTLVLAVVEILVDALEREAIRRMESGRLTDEEVDRLGQQLAAIETQIEEIEADHELEDDvaNLRGDL 82  Halovivax rub...
CCQ35955         4 TLDEESEDVRGGLTALVVTVVELLVEALEQEAVRRMESGSLTEDEIERLGQQLQALEEELEQMKRREEIGEDvtEFKQNL 83  Natronomonas ...
Q18JB1           4 TLDNQDSDVSGGIIALVVSVVELLVEALEQEAVRRMESGNLSDAEVERLGRQLQAIETEIEQLKQRENIDDDvtEFKRDL 83  Haloquadratum...
ELY25655         4 TLDGEADDVQGGLTALVVTVVELLVEALEQEAVRRMEAGDLSAAEIERLGQQLQTLEEEVERLKQQEDIGDEvaAFKSDL 83  Halogeometric...
P24375           4 ALDDDADDLQGGLTALVVTVVELLVEALEQEAVRRMESGSLSEDEIERLGRQLQALEDELERLKQQEDINAEvsEFREDL 83  Halobacterium...
P33963           5 ldDHDDEDLQSGLTALVVTVVELLVEALEGEAVRRMESGSLSDAEIERLGSQLQALEAELDRLQADQDIEAAvdEFKDDL 84  Halobacterium...
Q1D8P0          24 KLELDEENVQAGLVRLVLAVVELIRQLLERQALRRIDAGSLSEEQIERLGVTFLRLQEQMDVLKKQFDLTDE--DLNLDL 101 Myxococcus xa...
jgi:Desti_4952  37 RLNLNQDSVKNGLGQLVLTLVKLLHDLLERQAIRRMEAGTLTDTEIDRLGTTLMMQAQEIERLRSEFGLEEE--DLNLDL 114 Desulfomonile...
ABM03090        26 glNLESDDLKNGLGRLVLTLVKLLHELLERQALRRMDAGSLQDDEIERLGLAFMKQAEEIDRLRKEFGLEVE--DLNLDL 103 Psychromonas ...
AEB09619        38 RINLDQDNLKNSLGQLVLTLVKLLHELLERQSIRRIEAGSLTEDQIERLGVTLMRQAQEIDRLRQEFGLEEE--DLNIDL 115 Desulfobacca ...
jgi:Halru_1918  83 DNL 85  Halovivax ruber XH-70
CCQ35955        84 DHL 86  Natronomonas moolapensis 8.8.11
Q18JB1          84 DHV 86  Haloquadratum walsbyi DSM 16790
ELY25655        84 DHV 86  Halogeometricum borinquense DSM 11551
P24375          84 DHV 86  Halobacterium salinarum NRC-1
P33963          85 DHV 87  Halobacterium salinarum NRC-1
Q1D8P0         102 GPL 104 Myxococcus xanthus DK 1622
jgi:Desti_4952 115 GPL 117 Desulfomonile tiedjei DSM 6799
ABM03090       104 GPL 106 Psychromonas ingrahamii 37
AEB09619       116 GPL 118 Desulfobacca acetoxidans DSM 11109
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap