Conserved Protein Domain Family
Terminase_4

?
pfam05119: Terminase_4 
Phage terminase, small subunit
Statistics
?
PSSM-Id: 398679
Aligned: 107 rows
Threshold Bit Score: 53.8001
Threshold Setting Gi: 348595235
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q03VN0          53 VTLWRKLVPELKRLGTIKQIDTVNLEAFCSLYGTYRMAESDVQKNGIFVSFEVDKteideetgeevvvgketqydRSKKN 132 Leuconostoc m...
tigr:GBAA_4095  19 KDTWIRIWSVLEGEGKADINDPIVVEAIAFSYQMFREMAANVKKEGLTMEYTNKAga-----------------tNLTKH 81  Bacillus anth...
Q5L2L8          18 KKLFQILIQELEKENNLNDRTLMIVDNMVLLEQLKQEHMEDIKQRGVMELFKNGSq------------------eMFREN 79  Geobacillus k...
Q65KG7           7 KKIREYLGDR------YKESDEELIELYVDTHKFYRRLKKEVAENPLMMRHTNKAga-----------------eNLVKN 63  Bacillus lich...
CDB03375         4 agyeKRIIKKMTAVNTYRPEFDQTIKILAKIYEEFDKAKEQFEESGGEYVITYTNksg---------------vsNMIKN 68  Firmicutes ba...
Q9CGR0           8 eTIYKDTIAQMKQLKTYNYAFNRLVRIYAGMVRQYYEALKVWEEEGSPISTLSASn-------------------STKKH 68  Lactococcus l...
BAH43890         9 aavkRTTIRDMKSLGTYKKEYDRIIEIYAELVEQYAILNERFASEGYQYEVSTADg-------------------STKKA 69  Brevibacillus...
MA:Aflv_0660    17 kvfisEIKRQMKSLGTYKKEYDRMIEIFAGMLHQYYVFEEQFAESGYKITELYTNkag---------------atNERKT 81  Anoxybacillus...
Q81D02          20 deerNRIIRLLTEDDNFTPSLEPLIDNYLDAFIIYKTMFEEWKADGFAPTKTHKNkag---------------avNEMKH 84  Bacillus cere...
WP_015928669    30 REHWRVITTELRERNLLAPVNGHAIQRLVCARVLYDRSLRQVAESGSVSRPRRGNak-----------------aIARLS 92  Methylobacter...
Q03VN0         133 PAYSIMNDSIKTLKSLAVDLGLSFDARSGQLV 164 Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
tigr:GBAA_4095  82 TLIPEIPKYLQQIRQYLGELGLTGASRKKLQE 113 Bacillus anthracis str. 'Ames Ancestor'
Q5L2L8          80 KSVDKILKIVEQQRKLQAELKLTPASEKKVTE 111 Geobacillus kaustophilus
Q65KG7          64 PLAIELTKTVTTLNNLLKSLDLTPAQRKELNA 95  Bacillus licheniformis DSM 13 = ATCC 14580
CDB03375        69 PIYKIIEDMEDRILAYNRELGLTPVGYKRIMN 100 Firmicutes bacterium CAG:145
Q9CGR0          69 PALDQIEKLRKDILSYSNQLMLNPKSQRDSET 100 Lactococcus lactis subsp. lactis
BAH43890        70 PIVATLESLRKDILAYTDRLCLNPKTIDGIKI 101 Brevibacillus brevis NBRC 100599
MA:Aflv_0660    82 PLYTAMESLRKDIATYSDRLCLNPKSFESITV 113 Anoxybacillus flavithermus WK1
Q81D02          85 PLAQQVETWNDKKNKMLEALGMTNKGKSVQKT 116 Bacillus cereus ATCC 14579
WP_015928669    93 PHHTAMRELASDAAALEAELGLSPRRRGAVTK 124 Methylobacterium nodulans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap